Q14197 · ICT1_HUMAN
- ProteinLarge ribosomal subunit protein mL62
- GeneMRPL58
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids206 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit (PubMed:20186120, PubMed:33878294).
Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation (PubMed:33878294).
Involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes (PubMed:20186120, PubMed:33878294).
Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation (PubMed:33878294).
Involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes (PubMed:20186120, PubMed:33878294).
Catalytic activity
- an N-acyl-L-alpha-aminoacyl-tRNA + H2O = a tRNA + an N-acyl-L-amino acid + H+This reaction proceeds in the forward direction.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial large ribosomal subunit | |
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | aminoacyl-tRNA hydrolase activity | |
Molecular Function | translation release factor activity, codon nonspecific | |
Biological Process | mitochondrial translation | |
Biological Process | mitochondrial translational termination | |
Biological Process | rescue of stalled ribosome |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLarge ribosomal subunit protein mL62
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ14197
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_020045 | 8 | in dbSNP:rs3744206 | |||
Sequence: R → P | ||||||
Natural variant | VAR_024604 | 77 | in dbSNP:rs10512599 | |||
Sequence: L → F | ||||||
Mutagenesis | 88 | Strongly impairs peptide release activity. | ||||
Sequence: G → A | ||||||
Mutagenesis | 89 | Strongly impairs peptide release activity. | ||||
Sequence: G → S | ||||||
Natural variant | VAR_061767 | 122 | in dbSNP:rs34496172 | |||
Sequence: T → M |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 252 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for transit peptide, chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Transit peptide | 1-29 | UniProt | Mitochondrion | ||||
Sequence: MAATRCLRWGLSRAGVWLLPPPARCPRRA | |||||||
Chain | PRO_0000030339 | 30-206 | UniProt | Large ribosomal subunit protein mL62 | |||
Sequence: LHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD | |||||||
Modified residue (large scale data) | 49 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 90 | UniProt | N5-methylglutamine | ||||
Sequence: Q |
Post-translational modification
Methylation of glutamine in the GGQ triplet by HEMK1.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Down-regulated during the in vitro differentiation of HT29-D4 colon carcinoma cells.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the mitochondrial large ribosomal subunit (mt-LSU) (PubMed:20186120, PubMed:25278503, PubMed:25838379, PubMed:28892042, PubMed:35177605).
Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins
Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length206
- Mass (Da)23,630
- Last updated1996-11-01 v1
- Checksum663BF52443D41540
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 94 | in Ref. 4; BAD96273 | ||||
Sequence: K → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X81788 EMBL· GenBank· DDBJ | CAA57387.1 EMBL· GenBank· DDBJ | mRNA | ||
BT007111 EMBL· GenBank· DDBJ | AAP35775.1 EMBL· GenBank· DDBJ | mRNA | ||
AK222553 EMBL· GenBank· DDBJ | BAD96273.1 EMBL· GenBank· DDBJ | mRNA | ||
AK314138 EMBL· GenBank· DDBJ | BAG36828.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471099 EMBL· GenBank· DDBJ | EAW89227.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC015335 EMBL· GenBank· DDBJ | AAH15335.1 EMBL· GenBank· DDBJ | mRNA |