Q14195 · DPYL3_HUMAN
- ProteinDihydropyrimidinase-related protein 3
- GeneDPYSL3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids570 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell body | |
Cellular Component | cytosol | |
Cellular Component | exocytic vesicle | |
Cellular Component | extracellular space | |
Cellular Component | filamentous actin | |
Cellular Component | growth cone | |
Cellular Component | lamellipodium | |
Cellular Component | synapse | |
Molecular Function | chondroitin sulfate binding | |
Molecular Function | filamin binding | |
Molecular Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides | |
Molecular Function | identical protein binding | |
Molecular Function | SH3 domain binding | |
Biological Process | actin crosslink formation | |
Biological Process | actin filament bundle assembly | |
Biological Process | cellular response to cytokine stimulus | |
Biological Process | negative regulation of cell migration | |
Biological Process | negative regulation of neuron projection development | |
Biological Process | neuron development | |
Biological Process | positive regulation of filopodium assembly | |
Biological Process | positive regulation of neuron projection development | |
Biological Process | response to axon injury |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameDihydropyrimidinase-related protein 3
- Short namesDRP-3
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ14195
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with synaptic vesicle protein 2 in the central region of the growth cone.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_020485 | 442 | in dbSNP:rs2304044 | |||
Sequence: A → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 659 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000165917 | 1-570 | UniProt | Dihydropyrimidinase-related protein 3 | |||
Sequence: MSYQGKKNIPRITSDRLLIKGGRIVNDDQSFYADIYMEDGLIKQIGDNLIVPGGVKTIEANGKMVIPGGIDVHTHFQMPYKGMTTVDDFFQGTKAALAGGTTMIIDHVVPEPESSLTEAYEKWREWADGKSCCDYALHVDITHWNDSVKQEVQNLIKDKGVNSFMVYMAYKDLYQVSNTELYEIFTCLGELGAIAQVHAENGDIIAQEQTRMLEMGITGPEGHVLSRPEELEAEAVFRAITIASQTNCPLYVTKVMSKSAADLISQARKKGNVVFGEPITASLGIDGTHYWSKNWAKAAAFVTSPPLSPDPTTPDYINSLLASGDLQLSGSAHCTFSTAQKAIGKDNFTAIPEGTNGVEERMSVIWDKAVATGKMDENQFVAVTSTNAAKIFNLYPRKGRISVGSDSDLVIWDPDAVKIVSAKNHQSAAEYNIFEGMELRGAPLVVICQGKIMLEDGNLHVTQGAGRFIPCSPFSDYVYKRIKARRKMADLHAVPRGMYDGPVFDLTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS | |||||||
Modified residue (large scale data) | 2 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 32 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 102 | UniProt | In isoform Q14195-2; Phosphoserine | ||||
Sequence: T | |||||||
Modified residue | 259 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 259 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 402 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 431 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 472 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 499 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 507 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 508 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 509 | UniProt | Phosphothreonine; by GSK3 | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 509 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 514 | UniProt | Phosphothreonine; by GSK3 | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 514 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 518 | UniProt | Phosphoserine; by GSK3 | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 518 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 522 | UniProt | Phosphoserine; by DYRK2 | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 522 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 524 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 536 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 536 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 539 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 539 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 541 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 541 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 543 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 543 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 551 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylation on Ser-522 by DYRK2 promotes subsequent phosphorylation on Thr-509, Thr-514 and Ser-518 by GSK3.
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Tissue specificity
Mainly expressed in heart and skeletal muscle. Also strongly expressed in fetal brain and spinal cord.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homotetramer, and heterotetramer with CRMP1, DPYSL2, DPYSL4 or DPYSL5 (By similarity).
Interacts with synaptic vesicle protein 2 and SH3A domain of intersectin (By similarity).
Interacts with FLNA (PubMed:25358863).
Interacts with synaptic vesicle protein 2 and SH3A domain of intersectin (By similarity).
Interacts with FLNA (PubMed:25358863).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q14195 | ACD Q96AP0 | 2 | EBI-1104726, EBI-717666 | |
BINARY | Q14195 | DPYSL2 Q16555 | 7 | EBI-1104726, EBI-1104711 | |
BINARY | Q14195-2 | CRMP1 Q14194 | 6 | EBI-10232496, EBI-473101 | |
BINARY | Q14195-2 | DPYSL2 Q16555 | 10 | EBI-10232496, EBI-1104711 | |
BINARY | Q14195-2 | DPYSL5 Q9BPU6 | 3 | EBI-10232496, EBI-724653 | |
BINARY | Q14195-2 | OTUD6A Q7L8S5 | 3 | EBI-10232496, EBI-11960139 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 506-570 | Disordered | ||||
Sequence: LTTTPKGGTPAGSARGSPTRPNPPVRNLHQSGFSLSGTQVDEGVRSASKRIVAPPGGRSNITSLS | ||||||
Compositional bias | 528-548 | Polar residues | ||||
Sequence: PPVRNLHQSGFSLSGTQVDEG |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q14195-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length570
- Mass (Da)61,963
- Last updated1996-11-01 v1
- Checksum9D6AFE86CBB33AD5
Q14195-2
- NameLCRMP-4
- Differences from canonical
- 1-13: MSYQGKKNIPRIT → MASGRRGWDSSHEDDLPVYLARPGTTDQVPRQKYGGMFCNVEGAFESKTLDFDALSVGQRGAKTPRSGQGSDRGSGSRPGIEGDTPRRGQGREESREPAPASPAPAGVEIRSATGKEVLQNLGPKDK
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_042546 | 1-13 | in isoform LCRMP-4 | |||
Sequence: MSYQGKKNIPRIT → MASGRRGWDSSHEDDLPVYLARPGTTDQVPRQKYGGMFCNVEGAFESKTLDFDALSVGQRGAKTPRSGQGSDRGSGSRPGIEGDTPRRGQGREESREPAPASPAPAGVEIRSATGKEVLQNLGPKDK | ||||||
Sequence conflict | 49 | in Ref. 2; CAA69153 | ||||
Sequence: L → V | ||||||
Sequence conflict | 142 | in Ref. 2; CAA69153 | ||||
Sequence: T → A | ||||||
Compositional bias | 528-548 | Polar residues | ||||
Sequence: PPVRNLHQSGFSLSGTQVDEG |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D78014 EMBL· GenBank· DDBJ | BAA11192.1 EMBL· GenBank· DDBJ | mRNA | ||
Y07818 EMBL· GenBank· DDBJ | CAA69153.1 EMBL· GenBank· DDBJ | mRNA | ||
EU007906 EMBL· GenBank· DDBJ | ABV80252.1 EMBL· GenBank· DDBJ | mRNA | ||
AC011373 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |