Q13972 · RGRF1_HUMAN
- ProteinRas-specific guanine nucleotide-releasing factor 1
- GeneRASGRF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1273 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Promotes the exchange of Ras-bound GDP by GTP.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | growth cone | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Molecular Function | glutamate receptor binding | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Biological Process | activation of GTPase activity | |
Biological Process | long-term memory | |
Biological Process | neuron projection development | |
Biological Process | positive regulation of GTPase activity | |
Biological Process | positive regulation of Ras protein signal transduction | |
Biological Process | Ras protein signal transduction | |
Biological Process | regulation of neuronal synaptic plasticity | |
Biological Process | regulation of Rac protein signal transduction | |
Biological Process | regulation of Ras protein signal transduction | |
Biological Process | regulation of synaptic plasticity | |
Biological Process | response to endoplasmic reticulum stress | |
Biological Process | signal transduction | |
Biological Process | type B pancreatic cell proliferation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRas-specific guanine nucleotide-releasing factor 1
- Short namesRas-GRF1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ13972
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,080 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000068880 | 1-1273 | UniProt | Ras-specific guanine nucleotide-releasing factor 1 | |||
Sequence: MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEITSLLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENSKVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSNGYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNGVVMTSCRELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLEEITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPKLPT | |||||||
Modified residue | 577 | UniProt | Phosphoserine; by PLK2 | ||||
Sequence: S | |||||||
Modified residue | 626 | UniProt | Phosphoserine; by PLK2 | ||||
Sequence: S | |||||||
Modified residue | 758 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 779 | UniProt | Phosphoserine; by PLK2 | ||||
Sequence: S | |||||||
Modified residue | 800 | UniProt | Phosphoserine; by PLK2 | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 857 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated by PLK2, leading to ubiquitination and degradation by the proteasome.
Ubiquitinated and degraded following phosphorylation by PLK2.
Phosphorylated by SRC and LCK. Phosphorylation by LCK increases its capacity to stimulate the GDP/GTP exchange on Ras, whereas its phosphorylation by SRC seems not to have an effect on stimulation activity.
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-129 | PH 1 | ||||
Sequence: DGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSSRPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEWVAAIAHASY | ||||||
Domain | 204-229 | IQ | ||||
Sequence: KKIKKVQSFLRGWLCRRKWKTIIQDY | ||||||
Domain | 240-426 | DH | ||||
Sequence: KRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLLKHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELSRIMHDE | ||||||
Domain | 467-584 | PH 2 | ||||
Sequence: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSGQDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVD | ||||||
Domain | 644-761 | N-terminal Ras-GEF | ||||
Sequence: KVLQIRYASVERLLERLTDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNNKLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNI | ||||||
Region | 724-754 | Disordered | ||||
Sequence: YGEPPKSPRATRKFSSPPPLSITKTSSPSRR | ||||||
Compositional bias | 737-754 | Polar residues | ||||
Sequence: FSSPPPLSITKTSSPSRR | ||||||
Region | 809-874 | Disordered | ||||
Sequence: TNKIPDEGDTTPEKPEDPSALSKQSSEVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSS | ||||||
Compositional bias | 851-874 | Polar residues | ||||
Sequence: DGDTETSPTKSPTTPKSVKNKNSS | ||||||
Domain | 1038-1270 | Ras-GEF | ||||
Sequence: SALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIMKTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSAIFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESLYESSLRIEPK |
Domain
The DH (DBL-homology) domain mediates interaction with RASGRF2.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
Q13972-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,273
- Mass (Da)145,234
- Last updated2014-04-16 v2
- ChecksumB629AEAFDC7E500A
Q13972-2
- Name2
- Differences from canonical
- 1-784: Missing
Q13972-3
- Name3
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_012032 | 1-784 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_054072 | 610-622 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_054073 | 705-707 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 737-754 | Polar residues | ||||
Sequence: FSSPPPLSITKTSSPSRR | ||||||
Compositional bias | 851-874 | Polar residues | ||||
Sequence: DGDTETSPTKSPTTPKSVKNKNSS | ||||||
Sequence conflict | 1053 | in Ref. 6; M91815 | ||||
Sequence: V → A | ||||||
Sequence conflict | 1111 | in Ref. 6; M91815 | ||||
Sequence: E → G | ||||||
Sequence conflict | 1134 | in Ref. 6; M91815 | ||||
Sequence: S → C |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L26584 EMBL· GenBank· DDBJ | AAA58417.1 EMBL· GenBank· DDBJ | mRNA | ||
S62035 EMBL· GenBank· DDBJ | AAB26881.1 EMBL· GenBank· DDBJ | mRNA | ||
AC011944 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC104231 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471136 EMBL· GenBank· DDBJ | EAW99141.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK226101 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
M91815 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |