Q13319 · CD5R2_HUMAN
- ProteinCyclin-dependent kinase 5 activator 2
- GeneCDK5R2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids367 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Activator of CDK5/TPKII.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cyclin-dependent protein kinase holoenzyme complex | |
Cellular Component | cytoplasm | |
Cellular Component | growth cone | |
Cellular Component | membrane | |
Cellular Component | neuron projection | |
Cellular Component | plasma membrane | |
Cellular Component | protein kinase 5 complex | |
Molecular Function | actin binding | |
Molecular Function | cyclin-dependent protein serine/threonine kinase activator activity | |
Molecular Function | lipid binding | |
Molecular Function | protein kinase binding | |
Biological Process | axon guidance | |
Biological Process | brain development | |
Biological Process | cerebellum development | |
Biological Process | hippocampus development | |
Biological Process | layer formation in cerebral cortex | |
Biological Process | neuron migration | |
Biological Process | positive regulation of calcium ion-dependent exocytosis | |
Biological Process | regulation of cyclin-dependent protein serine/threonine kinase activity | |
Biological Process | superior olivary nucleus maturation |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCyclin-dependent kinase 5 activator 2
- Short namesCDK5 activator 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ13319
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 2 | Absent from the cell periphery. | ||||
Sequence: G → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 340 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, initiator methionine, propeptide, lipidation, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000004801 | ?-367 | UniProt | Cyclin-dependent kinase 5 activator 2 | |||
Sequence: MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR | |||||||
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Propeptide | PRO_0000004800 | 2-? | UniProt | ||||
Sequence: M | |||||||
Lipidation | 2 | UniProt | N-myristoyl glycine | ||||
Sequence: G | |||||||
Modified residue | 84 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 84 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Myristoylated. The Gly-2-Ala mutant is absent of the cell periphery, suggesting that a proper myristoylation signal is essential for the proper distribution of CDK5R2 (p39).
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Heterodimer of a catalytic subunit and a regulatory subunit.
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-56 | Disordered | ||||
Sequence: MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKR | ||||||
Region | 72-98 | Disordered | ||||
Sequence: ASAKKKKGSKKVTPKPASTGPDPLVQQ | ||||||
Region | 131-175 | Disordered | ||||
Sequence: AAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPR | ||||||
Compositional bias | 150-170 | Pro residues | ||||
Sequence: SGGGKPPPPPPPAPQVAPPVP | ||||||
Region | 329-367 | Disordered | ||||
Sequence: GEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR |
Sequence similarities
Belongs to the cyclin-dependent kinase 5 activator family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length367
- Mass (Da)38,705
- Last updated1997-11-01 v1
- ChecksumD8CBB7C8E0AA8200
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 150-170 | Pro residues | ||||
Sequence: SGGGKPPPPPPPAPQVAPPVP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U34051 EMBL· GenBank· DDBJ | AAC50278.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ307839 EMBL· GenBank· DDBJ | ABB96255.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC097468 EMBL· GenBank· DDBJ | AAX88916.1 EMBL· GenBank· DDBJ | Genomic DNA |