Q13291 · SLAF1_HUMAN
- ProteinSignaling lymphocytic activation molecule
- GeneSLAMF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids335 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
However, signaling is also regulated by SH2D1A which can simultaneously interact with and recruit FYN which subsequently phosphorylates and activates SLAMF1 (PubMed:12458214).
Mediates IL-2-independent proliferation of activated T-cells during immune responses and induces IFN-gamma production (By similarity).
Downstreaming signaling involves INPP5D, DOK1 and DOK2 leading to inhibited IFN-gamma production in T-cells, and PRKCQ, BCL10 and NFKB1 leading to increased T-cell activation and Th2 cytokine production (By similarity).
Promotes T-cell receptor-induced IL-4 secretion by CD4+ cells (By similarity).
Inhibits antigen receptor-mediated production of IFN-gamma, but not IL-2, in CD4-/CD8- T-cells (By similarity).
Required for IL-4 production by germinal centers T follicular helper (T(Fh))cells (By similarity).
May inhibit CD40-induced signal transduction in monocyte-derived dendritic cells (PubMed:16317102).
May play a role in allergic responses and may regulate allergen-induced Th2 cytokine and Th1 cytokine secretion (By similarity).
In conjunction with SLAMF6 controls the transition between positive selection and the subsequent expansion and differentiation of the thymocytic natural killer T (NKT) cell lineage. Involved in the peripheral differentiation of indifferent natural killer T (iNKT) cells toward a regulatory NKT2 type (By similarity).
In macrophages involved in down-regulation of IL-12, TNF-alpha and nitric oxide in response to lipopolysaccharide (LPS) (By similarity).
In B-cells activates the ERK signaling pathway independently of SH2D1A but implicating both, SYK and INPP5D, and activates Akt signaling dependent on SYK and SH2D1A (By similarity).
In B-cells also activates p38 MAPK and JNK1 and JNK2 (PubMed:20231852).
In conjunction with CD84/SLAMF5 and SLAMF6 may be a negative regulator of the humoral immune response (By similarity).
Involved in innate immune response against Gram-negative bacteria in macrophages; probably recognizes OmpC and/or OmpF on the bacterial surface, regulates phagosome maturation and recruitment of the PI3K complex II (PI3KC3-C2) leading to accumulation of PdtIns3P and NOX2 activity in the phagosomes (PubMed:20818396).
GO annotations
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSignaling lymphocytic activation molecule
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ13291
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Isoform 3
Isoform 4
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 21-237 | Extracellular | ||||
Sequence: ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP | ||||||
Transmembrane | 238-258 | Helical | ||||
Sequence: WAVYAGLLGGVIMILIMVVIL | ||||||
Topological domain | 259-335 | Cytoplasmic | ||||
Sequence: QLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_021924 | 11 | in dbSNP:rs2295612 | |||
Sequence: F → L | ||||||
Natural variant | VAR_035524 | 81 | in a breast cancer sample; somatic mutation; dbSNP:rs1373814964 | |||
Sequence: L → F | ||||||
Mutagenesis | 269 | No effect on interaction with INPP5D/SHIP-1, PTPN11/SHP-2 and SH2D1A. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 279 | Disrupts interaction with SH2D1A; when associated with A-325. | ||||
Sequence: T → A | ||||||
Mutagenesis | 281 | Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 281 | Disrupts interaction with SH2D1A; when associated with F-327. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 307 | No effect on interaction with PTPN11/SHP-2 and SH2D1A. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 325 | Disrupts interaction with SH2D1A; when associated with A-279. | ||||
Sequence: T → A | ||||||
Mutagenesis | 327 | Disrupts interaction with INPP5D/SHIP-1 and PTPN11/SHP-2, no effect on interaction with SH2D1A. | ||||
Sequence: Y → F | ||||||
Mutagenesis | 327 | Disrupts interaction with SH2D1A; when associated with F-281. | ||||
Sequence: Y → F | ||||||
Natural variant | VAR_021925 | 333 | in dbSNP:rs3796504 | |||
Sequence: P → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 457 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, glycosylation, disulfide bond, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-20 | UniProt | |||||
Sequence: MDPKGLLSLTFVLFLSLAFG | |||||||
Chain | PRO_0000014959 | 21-335 | UniProt | Signaling lymphocytic activation molecule | |||
Sequence: ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES | |||||||
Glycosylation | 53 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 57 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 102 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 125 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 150 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 155 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Disulfide bond | 158↔228 | UniProt | |||||
Sequence: CTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGC | |||||||
Disulfide bond | 164↔209 | UniProt | |||||
Sequence: CTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYIC | |||||||
Glycosylation | 189 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 217 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue | 281 | UniProt | Phosphotyrosine; by FYN | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 281 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 307 | UniProt | Phosphotyrosine; by FYN | ||||
Sequence: Y | |||||||
Modified residue | 327 | UniProt | Phosphotyrosine; by FYN | ||||
Sequence: Y |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Activated B-cells express isoform 1, isoform 3 and a cytoplasmic isoform (PubMed:9091591).
Isoform 4 is expressed in B-cells, primary T-cells, dendritic cells and macrophages. Isoform 4 is expressed in tumors of the central nervous system (PubMed:25710480).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts (via cytoplasmic domain phosphorylated on tyrosine residues) with INPP5D and PTPN11; presence of SH2D1A facilitates binding to INPP5D (PubMed:11313386, PubMed:12458214).
Interacts with MAP4K1 (PubMed:20231852).
Interacts with PIK3C3, BECN1 and UVRAG; indicative for an association with PI3K complex II (PI3KC3-C2) (PubMed:20818396).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | Q13291 | H Q786F2 | 2 | EBI-4315002, EBI-5323300 | |
BINARY | Q13291 | MAP4K1 Q92918 | 3 | EBI-4315002, EBI-881 | |
BINARY | Q13291 | SH2D1A O60880 | 12 | EBI-4315002, EBI-6983382 | |
BINARY | Q13291 | SH2D1A O60880-1 | 2 | EBI-4315002, EBI-15552052 | |
BINARY | Q13291 | SLAMF1 Q13291 | 2 | EBI-4315002, EBI-4315002 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 29-138 | Ig-like V-type | ||||
Sequence: MMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLY | ||||||
Domain | 144-223 | Ig-like C2-type | ||||
Sequence: PEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFS | ||||||
Motif | 279-284 | ITSM 1 | ||||
Sequence: TIYAQV | ||||||
Motif | 307-312 | SH2-binding | ||||
Sequence: YVAATE | ||||||
Motif | 325-330 | ITSM 2 | ||||
Sequence: TVYASV |
Domain
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 4 isoforms produced by Alternative splicing. Additional isoforms seem to exist.
Q13291-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsLong, mCD150
- Length335
- Mass (Da)37,231
- Last updated1996-11-01 v1
- ChecksumBFB0F27EA31D8C04
Q13291-2
- Name2
- SynonymsShort, SURslam2, vmSLAM
Q13291-3
- Name3
- SynonymsSecreted, SECslam, sSLAM
- Differences from canonical
- 234-263: Missing
Q13291-4
- Name4
- SynonymsnCD150
- Differences from canonical
- 264-335: GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES → ATLTTTNQYWSQNVLTQDQERCPGCLPMVKRTITRQQWKKKALRSMPKSRNQVLFRRNLTPSQLRTLAPPYMLLPQSLSQSLSRKQIPSQSMLV
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_002567 | 234-263 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_058033 | 264-335 | in isoform 4 | |||
Sequence: GKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES → ATLTTTNQYWSQNVLTQDQERCPGCLPMVKRTITRQQWKKKALRSMPKSRNQVLFRRNLTPSQLRTLAPPYMLLPQSLSQSLSRKQIPSQSMLV | ||||||
Alternative sequence | VSP_002568 | 289-298 | in isoform 2 | |||
Sequence: PLQKKLDSFP → DTHHQTSDLF | ||||||
Alternative sequence | VSP_002569 | 299-335 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U33017 EMBL· GenBank· DDBJ | AAA75380.1 EMBL· GenBank· DDBJ | mRNA | ||
KF471075 EMBL· GenBank· DDBJ | AHF72732.1 EMBL· GenBank· DDBJ | mRNA | ||
AL121985 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL138930 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471121 EMBL· GenBank· DDBJ | EAW52706.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC132792 EMBL· GenBank· DDBJ | AAI32793.1 EMBL· GenBank· DDBJ | mRNA | ||
AF252305 EMBL· GenBank· DDBJ | AAG10434.1 EMBL· GenBank· DDBJ | Genomic DNA |