Q13286 · CLN3_HUMAN
- ProteinBattenin
- GeneCLN3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids438 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Facilitates the proteins transport from trans-Golgi network (TGN)-to other membrane compartments such as transport of microdomain-associated proteins to the plasma membrane, IGF2R transport to the lysosome where it regulates the CTSD release leading to regulation of CTSD maturation and thereby APP intracellular processing (PubMed:10924275, PubMed:18817525).
Moreover regulates CTSD activity in response to osmotic stress (PubMed:23840424, PubMed:28390177).
Also binds galactosylceramide and transports it from the trans Golgi to the rafts, which may have immediate and downstream effects on cell survival by modulating ceramide synthesis (PubMed:18317235).
At the plasma membrane, regulates actin-dependent events including filopodia formation, cell migration, and pinocytosis through ARF1-CDC42 pathway and also the cytoskeleton organization through interaction with MYH10 and fodrin leading to the regulation of the plasma membrane association of Na+, K+ ATPase complex (PubMed:20850431).
Regulates synaptic transmission in the amygdala, hippocampus, and cerebellum through regulation of synaptic vesicles density and their proximity to active zones leading to modulation of short-term plasticity and age-dependent anxious behavior, learning and memory (By similarity).
Regulates autophagic vacuoles (AVs) maturation by modulating the trafficking between endocytic and autophagolysosomal/lysosomal compartments, which involves vesicle fusion leading to regulation of degradation process (By similarity).
Participates also in cellular homeostasis of compounds such as, water, ions, amino acids, proteins and lipids in several tissue namely in brain and kidney through regulation of their transport and synthesis (PubMed:17482562).
GO annotations
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBattenin
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ13286
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Trafficks from cell membrane to Golgi via endosomes (PubMed:15240864).
Osmotic stress changes the subcellular localization of CLN3 (PubMed:23840424).
Trafficks to intracellular compartments via the plasma membranet through AP3M1-dependent mechanisms (PubMed:14644441).
Excluded from the synaptic vesicles (By similarity).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-37 | Cytoplasmic | ||||
Sequence: MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKN | ||||||
Transmembrane | 38-58 | Helical | ||||
Sequence: AVGFWLLGLCNNFSYVVMLSA | ||||||
Topological domain | 59-127 | Lumenal | ||||
Sequence: AHDILSHKRTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPR | ||||||
Transmembrane | 128-148 | Helical | ||||
Sequence: VLVSGICAAGSFVLVAFSHSV | ||||||
Topological domain | 149-151 | Cytoplasmic | ||||
Sequence: GTS | ||||||
Transmembrane | 152-172 | Helical | ||||
Sequence: LCGVVFASISSGLGEVTFLSL | ||||||
Topological domain | 173-182 | Lumenal | ||||
Sequence: TAFYPRAVIS | ||||||
Transmembrane | 183-203 | Helical | ||||
Sequence: WWSSGTGGAGLLGALSYLGLT | ||||||
Topological domain | 204-277 | Cytoplasmic | ||||
Sequence: QAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTV | ||||||
Transmembrane | 278-298 | Helical | ||||
Sequence: FKGLLWYIVPLVVVYFAEYFI | ||||||
Topological domain | 299-346 | Lumenal | ||||
Sequence: NQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTW | ||||||
Transmembrane | 347-367 | Helical | ||||
Sequence: ALALLQCLNLVFLLADVWFGF | ||||||
Topological domain | 368-438 | Cytoplasmic | ||||
Sequence: LPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Ceroid lipofuscinosis, neuronal, 3 (CLN3)
- Note
- DescriptionA form of neuronal ceroid lipofuscinosis. Neuronal ceroid lipofuscinoses are progressive neurodegenerative, lysosomal storage diseases characterized by intracellular accumulation of autofluorescent liposomal material, and clinically by seizures, dementia, visual loss, and/or cerebral atrophy. The hallmark of CLN3 is the ultrastructural pattern of lipopigment with a fingerprint profile, which can have 3 different appearances: pure within a lysosomal residual body; in conjunction with curvilinear or rectilinear profiles; and as a small component within large membrane-bound lysosomal vacuoles. The combination of fingerprint profiles within lysosomal vacuoles is a regular feature of blood lymphocytes from patients with neuronal ceroid lipofuscinosis type 3.
- See alsoMIM:204200
Natural variants in CLN3
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_005131 | 101 | L>P | in CLN3; dbSNP:rs386833714 | |
VAR_066892 | 134 | C>R | in CLN3; dbSNP:rs386833719 | |
VAR_005132 | 170 | L>P | in CLN3; Decreases synthesis of bis(monoacylglycerol)phosphate.; dbSNP:rs386833727 | |
VAR_066893 | 187 | G>A | in CLN3; dbSNP:rs386833730 | |
VAR_066894 | 189 | G>R | in CLN3; dbSNP:rs386833731 | |
VAR_005133 | 295 | E>K | in CLN3; the mutant is located to vesicles clustered in a perinuclear region. Does not affect protein synthesis and maturation. Does not affect lysosomal localization.; dbSNP:rs121434286 | |
VAR_005134 | 330 | V>F | in CLN3; dbSNP:rs386833744 | |
VAR_005135 | 334 | R>C | in CLN3; Does not affect lysosomal localization. Does not affect lysosomal protein catabolic process. Does not affect lysosomal pH; dbSNP:rs386833694 | |
VAR_005136 | 334 | R>H | in CLN3; dbSNP:rs386833695 | |
VAR_083168 | 399 | missing | in CLN3; Loss of lysosomal localization |
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_005131 | 101 | in CLN3; dbSNP:rs386833714 | |||
Sequence: L → P | ||||||
Natural variant | VAR_066892 | 134 | in CLN3; dbSNP:rs386833719 | |||
Sequence: C → R | ||||||
Natural variant | VAR_005132 | 170 | in CLN3; Decreases synthesis of bis(monoacylglycerol)phosphate.; dbSNP:rs386833727 | |||
Sequence: L → P | ||||||
Natural variant | VAR_066893 | 187 | in CLN3; dbSNP:rs386833730 | |||
Sequence: G → A | ||||||
Natural variant | VAR_066894 | 189 | in CLN3; dbSNP:rs386833731 | |||
Sequence: G → R | ||||||
Mutagenesis | 242-244 | Loss of lysosomal targeting; when associated with A-409 and A-419. Loss of lysosomal localization; when associated with A-246. | ||||
Sequence: EEE → AAA | ||||||
Mutagenesis | 246 | Loss of lysosomal localization; when associated with 242-A--A-244. | ||||
Sequence: E → A | ||||||
Mutagenesis | 253 | Loss of lysosomal targeting; when associated with A-254. Does not affect interaction with CLN5; when associated with A-254. Does not affect interaction with CLN5; when associated with A-254; A-409 and A-419. Loss of lysosomal targeting; when associated with A-254; A-409 and A-409. | ||||
Sequence: L → A | ||||||
Mutagenesis | 253-254 | Does not affect lysosomal localization in AP3D1 or AP2A2 or AP1G1 deficient cells. Abolishes the interaction of AP3D1, AP2A2 and AP1G1. Loss of lysosomal localization. | ||||
Sequence: LI → AA | ||||||
Mutagenesis | 254 | Loss of lysosomal targeting. Does not affect interaction with CLN5; when associated with A-253. Does not affect interaction with CLN5; when associated with A-253; A-409 and A-419. Loss of lysosomal targeting; when associated with A-253; A-409 and A-409. | ||||
Sequence: I → A | ||||||
Natural variant | VAR_005133 | 295 | in CLN3; the mutant is located to vesicles clustered in a perinuclear region. Does not affect protein synthesis and maturation. Does not affect lysosomal localization.; dbSNP:rs121434286 | |||
Sequence: E → K | ||||||
Mutagenesis | 310 | Does not affect glycosylation. | ||||
Sequence: N → Q | ||||||
Natural variant | VAR_005134 | 330 | in CLN3; dbSNP:rs386833744 | |||
Sequence: V → F | ||||||
Natural variant | VAR_005135 | 334 | in CLN3; Does not affect lysosomal localization. Does not affect lysosomal protein catabolic process. Does not affect lysosomal pH; dbSNP:rs386833694 | |||
Sequence: R → C | ||||||
Natural variant | VAR_005136 | 334 | in CLN3; dbSNP:rs386833695 | |||
Sequence: R → H | ||||||
Natural variant | VAR_083168 | 399 | in CLN3; Loss of lysosomal localization | |||
Sequence: Missing | ||||||
Mutagenesis | 409 | Does not affect lysosomal targeting; when associated with A-419. Loss of lysosomal targeting; when associated with A-253 and A-254. Loss of lysosomal targeting; when associated with 242-A--A-244 and A-419. Does not affect interaction with CLN5; when associated with A-419. Does not affect interaction with CLN5; when associated with A-253; A-254 and A-419. Loss of lysosomal targeting; when associated with A-253; A-254 and A-419. Loss of lysosomal localization in AP3D1 or AP1G1 deficient cells; when associated with A-419. | ||||
Sequence: M → A | ||||||
Mutagenesis | 419 | Does not affect lysosomal targeting; when associated with A-409. Loss of lysosomal targeting; when associated with A-253 and A-254. Loss of lysosomal targeting; when associated with 242-A--A-244 and A-409. Does not affect interaction with CLN5; when associated with A-409. Does not affect interaction with CLN5; when associated with A-253; A-254 and A-409. Loss of lysosomal targeting; when associated with A-253; A-254 and A-409. Loss of lysosomal localization in AP3D1 or AP1G1 deficient cells; when associated with A-409. | ||||
Sequence: G → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 669 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data), glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000089857 | 1-435 | UniProt | Battenin | |||
Sequence: MGGCAGSRRRFSDSEGEETVPEPRLPLLDHQGAHWKNAVGFWLLGLCNNFSYVVMLSAAHDILSHKRTSGNQSHVDPGPTPIPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICAAGSFVLVAFSHSVGTSLCGVVFASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQQTLLSMLGIPALLLASYFLLLTSPEAQDPGGEEEAESAARQPLIRTEAPESKPGSSSSLSLRERWTVFKGLLWYIVPLVVVYFAEYFINQGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLC | |||||||
Modified residue | 12 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 12 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 14 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 14 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 19 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Glycosylation | 71 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 85 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Glycosylation | 310 | UniProt | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | |||||||
Modified residue | 435 | UniProt | Cysteine methyl ester | ||||
Sequence: C | |||||||
Lipidation | 435 | UniProt | S-farnesyl cysteine | ||||
Sequence: C | |||||||
Propeptide | PRO_0000422290 | 436-438 | UniProt | Removed in mature form | |||
Sequence: QLS |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Induction
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with DCTN1, KIF3A, RAB7A and RILP (PubMed:22261744).
Interacts with CLN5 (PubMed:14699076, PubMed:19941651).
May interact with HOOK1 (PubMed:15471887).
Interacts with KCNIP3; this interaction is disrupted by intracellular increase of calcium level (PubMed:17189291).
Interacts with TPP1, CLN6 and CLN8 (PubMed:17237713).
Interacts with MYH10; this interaction may play a role in regulation of cytoskeleton organization (PubMed:20850431).
Interacts with SBDS (PubMed:20015955).
Interacts with sodium/potassium-transporting ATPase complex (via ATP1A1) and fodrin heteromer (via SPTAN1); this interaction regulates their localization at the plasma membrane (Probable). Interacts with HSPA5 (Probable). Interacts (via dileucine motif) with AP3D1 and AP1G1; this interaction facilitates lysosomal targeting (PubMed:15598649).
Interacts (via dileucine motif) with AP2A2 (PubMed:15598649).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q13286 | CDHR3 Q6ZTQ4 | 3 | EBI-3248760, EBI-12143631 | |
BINARY | Q13286 | CLN5 O75503 | 2 | EBI-3248760, EBI-1043514 | |
BINARY | Q13286 | IFT20 Q8IY31-3 | 3 | EBI-3248760, EBI-9091197 | |
BINARY | Q13286 | MAGEB6 Q8N7X4 | 3 | EBI-3248760, EBI-6447163 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-25 | Disordered | ||||
Sequence: MGGCAGSRRRFSDSEGEETVPEPRL | ||||||
Compositional bias | 10-24 | Basic and acidic residues | ||||
Sequence: RFSDSEGEETVPEPR | ||||||
Region | 237-268 | Disordered | ||||
Sequence: QDPGGEEEAESAARQPLIRTEAPESKPGSSSS | ||||||
Motif | 242-244 | Lysosomal targeting motif | ||||
Sequence: EEE | ||||||
Motif | 253-254 | Lysosomal targeting motif. Required for AP1G1, AP2A2 and AP3D1 interaction | ||||
Sequence: LI | ||||||
Motif | 409-419 | Lysosomal targeting motif | ||||
Sequence: MAATCISDTLG |
Domain
the dileucine motif mediates AP1G1 and AP3D1 interaction (PubMed:15598649).
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 7 isoforms produced by Alternative splicing. Additional isoforms seem to exist.
Q13286-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length438
- Mass (Da)47,623
- Last updated1996-11-01 v1
- ChecksumBE25E973CEEC4FD5
Q13286-2
- Name2
- Differences from canonical
- 178-225: Missing
Q13286-3
- Name3
- Differences from canonical
- 280-302: GLLWYIVPLVVVYFAEYFINQGL → VRMMAG
Q13286-4
- Name4
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
- Differences from canonical
- 322-438: Missing
Q13286-5
- Name5
- NoteMay be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Q13286-6
- Name6
Q13286-7
- Name7
- Differences from canonical
- 75-98: Missing
Computationally mapped potential isoform sequences
There are 28 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
O95086 | O95086_HUMAN | CLN3 | 336 | ||
O95090 | O95090_HUMAN | CLN3 | 167 | ||
H3BUF8 | H3BUF8_HUMAN | CLN3 | 53 | ||
H3BRU8 | H3BRU8_HUMAN | CLN3 | 28 | ||
H3BR00 | H3BR00_HUMAN | CLN3 | 155 | ||
H3BR84 | H3BR84_HUMAN | CLN3 | 176 | ||
H3BPL0 | H3BPL0_HUMAN | CLN3 | 74 | ||
H3BQ48 | H3BQ48_HUMAN | CLN3 | 176 | ||
H3BNK7 | H3BNK7_HUMAN | CLN3 | 228 | ||
H3BMN4 | H3BMN4_HUMAN | CLN3 | 218 | ||
Q2TA70 | Q2TA70_HUMAN | CLN3 | 360 | ||
A0A1B0GUU4 | A0A1B0GUU4_HUMAN | CLN3 | 182 | ||
A0A1B0GV71 | A0A1B0GV71_HUMAN | CLN3 | 370 | ||
A0A1B0GUX3 | A0A1B0GUX3_HUMAN | CLN3 | 135 | ||
A0A1B0GV41 | A0A1B0GV41_HUMAN | CLN3 | 269 | ||
A0A1B0GUB1 | A0A1B0GUB1_HUMAN | CLN3 | 77 | ||
A0A1B0GTS8 | A0A1B0GTS8_HUMAN | CLN3 | 47 | ||
A0A1B0GWH8 | A0A1B0GWH8_HUMAN | CLN3 | 52 | ||
A0A1B0GWH9 | A0A1B0GWH9_HUMAN | CLN3 | 159 | ||
A0A1B0GWD3 | A0A1B0GWD3_HUMAN | CLN3 | 399 | ||
A0A1B0GW90 | A0A1B0GW90_HUMAN | CLN3 | 370 | ||
A0A1B0GW34 | A0A1B0GW34_HUMAN | CLN3 | 363 | ||
B4DFF3 | B4DFF3_HUMAN | CLN3 | 384 | ||
A0A0D9SF04 | A0A0D9SF04_HUMAN | CLN3 | 82 | ||
F6TI76 | F6TI76_HUMAN | CLN3 | 285 | ||
Q9UP10 | Q9UP10_HUMAN | CLN3 | 131 | ||
Q9UBD8 | Q9UBD8_HUMAN | CLN3 | 181 | ||
Q9UBH5 | Q9UBH5_HUMAN | CLN3 | 105 |
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 10-24 | Basic and acidic residues | ||||
Sequence: RFSDSEGEETVPEPR | ||||||
Alternative sequence | VSP_057347 | 75-98 | in isoform 7 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_047631 | 99-127 | in isoform 6 | |||
Sequence: AVLLADILPTLVIKLLAPLGLHLLPYSPR → PPGSRQWDLCCWKLRPGCLFSFCGDQPVC | ||||||
Alternative sequence | VSP_047632 | 128-226 | in isoform 6 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_004169 | 155-264 | in isoform 5 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_004166 | 178-225 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 259 | in Ref. 5; BAG35838 | ||||
Sequence: P → L | ||||||
Alternative sequence | VSP_004167 | 280-302 | in isoform 3 | |||
Sequence: GLLWYIVPLVVVYFAEYFINQGL → VRMMAG | ||||||
Alternative sequence | VSP_004168 | 322-438 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_004170 | 353-438 | in isoform 5 | |||
Sequence: CLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS → MESRSVAQAGM |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U32680 EMBL· GenBank· DDBJ | AAB51075.1 EMBL· GenBank· DDBJ | mRNA | ||
X99832 EMBL· GenBank· DDBJ | CAA68148.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF015593 EMBL· GenBank· DDBJ | AAD01555.1 EMBL· GenBank· DDBJ | mRNA | ||
AF015598 EMBL· GenBank· DDBJ | AAD01560.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077956 EMBL· GenBank· DDBJ | AAD51478.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077957 EMBL· GenBank· DDBJ | AAD51479.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077958 EMBL· GenBank· DDBJ | AAD51480.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077959 EMBL· GenBank· DDBJ | AAD51481.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077961 EMBL· GenBank· DDBJ | AAD51483.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077962 EMBL· GenBank· DDBJ | AAD51484.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077966 EMBL· GenBank· DDBJ | AAD51488.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077960 EMBL· GenBank· DDBJ | AAD51482.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077963 EMBL· GenBank· DDBJ | AAD51485.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077965 EMBL· GenBank· DDBJ | AAD51487.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077971 EMBL· GenBank· DDBJ | AAD51493.1 EMBL· GenBank· DDBJ | mRNA | ||
AF077972 EMBL· GenBank· DDBJ | AAD51494.1 EMBL· GenBank· DDBJ | mRNA | ||
AF078169 EMBL· GenBank· DDBJ | AAD48543.1 EMBL· GenBank· DDBJ | mRNA | ||
AK302027 EMBL· GenBank· DDBJ | BAG63425.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313002 EMBL· GenBank· DDBJ | BAG35838.1 EMBL· GenBank· DDBJ | mRNA | ||
AC002425 EMBL· GenBank· DDBJ | AAC05337.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC002544 EMBL· GenBank· DDBJ | AAC27430.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC138894 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471279 EMBL· GenBank· DDBJ | EAW52281.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471279 EMBL· GenBank· DDBJ | EAW52286.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC002394 EMBL· GenBank· DDBJ | AAH02394.1 EMBL· GenBank· DDBJ | mRNA | ||
BC004433 EMBL· GenBank· DDBJ | AAH04433.1 EMBL· GenBank· DDBJ | mRNA |