Q13123 · RED_HUMAN
- ProteinProtein Red
- GeneIK
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids557 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in pre-mRNA splicing as a component of the spliceosome (PubMed:28781166).
Auxiliary spliceosomal protein that regulates selection of alternative splice sites in a small set of target pre-mRNA species (Probable). Required for normal mitotic cell cycle progression (PubMed:22351768, PubMed:24252166).
Recruits MAD1L1 and MAD2L1 to kinetochores, and is required to trigger the spindle assembly checkpoint (PubMed:22351768).
Required for normal accumulation of SMU1 (PubMed:24945353).
Auxiliary spliceosomal protein that regulates selection of alternative splice sites in a small set of target pre-mRNA species (Probable). Required for normal mitotic cell cycle progression (PubMed:22351768, PubMed:24252166).
Recruits MAD1L1 and MAD2L1 to kinetochores, and is required to trigger the spindle assembly checkpoint (PubMed:22351768).
Required for normal accumulation of SMU1 (PubMed:24945353).
(Microbial infection) Required, together with SMU1, for normal splicing of influenza A virus NS1 pre-mRNA, which is required for the production of the exportin NS2 and for the production of influenza A virus particles. Not required for the production of VSV virus particles.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromosome | |
Cellular Component | cytoplasm | |
Cellular Component | nuclear speck | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | spindle pole | |
Cellular Component | U2-type precatalytic spliceosome | |
Molecular Function | identical protein binding | |
Biological Process | mitotic cell cycle | |
Biological Process | mitotic spindle assembly checkpoint signaling | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | protein localization to kinetochore |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein Red
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ13123
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Predominantly present throughout the nucleoplasm during prometaphase, metaphase and anaphase. Is also detected in nuclear foci that are not identical with Cajal bodies. Starts to accumulate at chromosomes during telophase, and is nearly exclusively associated with chromosomes in newly divided cells (PubMed:24252166).
Colocalizes with MAD1L1 at mitotic spindle poles during metaphase and anaphase (PubMed:22351768).
Colocalizes with MAD1L1 at mitotic spindle poles during metaphase and anaphase (PubMed:22351768).
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 411 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue, cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000097235 | 1-557 | UniProt | Protein Red | |||
Sequence: MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDPAARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAAEKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKTRLGRNVYRMLFKSKAYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVISKLTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGWEGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYSEYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY | |||||||
Modified residue (large scale data) | 6 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 10 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 98 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 114 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 137 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Cross-link | 151 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 287 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 310 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 325 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Cross-link | 331 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 332 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 386 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 388 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 404 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 408 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 417 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 417 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 460 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 460 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 485 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 496 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 501 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 509 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 536 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 541 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 543 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 544 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 553 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous.
Induction
Up-regulated during mitosis (at protein level).
Developmental stage
Expressed at similar levels in fetal and adult tissues.
Gene expression databases
Organism-specific databases
Interaction
Subunit
(Microbial infection) Identified in a complex with SMU1 and influenza A virus RNA polymerase subunits PB1 and PB2. Directly interacts with SMU1 and with influenza A virus RNA polymerase subunits PB1 and PB2.
Component of the spliceosome B complex (PubMed:22365833, PubMed:28781166).
Interacts with SMU1 (PubMed:22365833, PubMed:24945353).
Interacts with MAD1L1 (PubMed:22351768).
May interact with DHX15 (PubMed:24252166).
Interacts with SMU1 (PubMed:22365833, PubMed:24945353).
Interacts with MAD1L1 (PubMed:22351768).
May interact with DHX15 (PubMed:24252166).
Binary interactions
Protein-protein interaction databases
Chemistry
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-84 | Disordered | ||||
Sequence: MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDPAARRRKKKSYYAKL | ||||||
Compositional bias | 17-34 | Basic and acidic residues | ||||
Sequence: GHDVDDPHSFHQSKLTNE | ||||||
Compositional bias | 55-75 | Basic and acidic residues | ||||
Sequence: SRHHEMPREYNEDEDPAARRR | ||||||
Region | 181-205 | Disordered | ||||
Sequence: KEKEEEELMEKPQKETKKDEDPENK | ||||||
Region | 294-403 | Disordered | ||||
Sequence: RNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRERDRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGST | ||||||
Compositional bias | 301-317 | Basic and acidic residues | ||||
Sequence: KDKGKLEEKKPPEADMN | ||||||
Compositional bias | 330-402 | Basic and acidic residues | ||||
Sequence: TKTPRDKERERYRERERDRERDRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGS | ||||||
Repeat | 342-343 | 1 | ||||
Sequence: RE | ||||||
Region | 342-375 | 17 X 2 AA tandem repeats of R-[ED] | ||||
Sequence: RERERDRERDRDRDRERERERDRERERERDRERE | ||||||
Repeat | 344-345 | 2 | ||||
Sequence: RE | ||||||
Repeat | 346-347 | 3 | ||||
Sequence: RD | ||||||
Repeat | 348-349 | 4 | ||||
Sequence: RE | ||||||
Repeat | 350-351 | 5 | ||||
Sequence: RD | ||||||
Repeat | 352-353 | 6 | ||||
Sequence: RD | ||||||
Repeat | 354-355 | 7 | ||||
Sequence: RD | ||||||
Repeat | 356-357 | 8 | ||||
Sequence: RE | ||||||
Repeat | 358-359 | 9 | ||||
Sequence: RE | ||||||
Repeat | 360-361 | 10 | ||||
Sequence: RE | ||||||
Repeat | 362-363 | 11 | ||||
Sequence: RD | ||||||
Repeat | 364-365 | 12 | ||||
Sequence: RE | ||||||
Repeat | 366-367 | 13 | ||||
Sequence: RE | ||||||
Repeat | 368-369 | 14 | ||||
Sequence: RE | ||||||
Repeat | 370-371 | 15 | ||||
Sequence: RD | ||||||
Repeat | 372-373 | 16 | ||||
Sequence: RE | ||||||
Repeat | 374-375 | 17 | ||||
Sequence: RE |
Sequence similarities
Belongs to the RED family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length557
- Mass (Da)65,602
- Last updated2010-05-18 v3
- ChecksumBE7B332985D5F4CA
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 17-34 | Basic and acidic residues | ||||
Sequence: GHDVDDPHSFHQSKLTNE | ||||||
Compositional bias | 55-75 | Basic and acidic residues | ||||
Sequence: SRHHEMPREYNEDEDPAARRR | ||||||
Sequence conflict | 176 | in Ref. 1; CAA06607 | ||||
Sequence: A → L | ||||||
Sequence conflict | 182 | in Ref. 1; CAA06607 | ||||
Sequence: E → D | ||||||
Compositional bias | 301-317 | Basic and acidic residues | ||||
Sequence: KDKGKLEEKKPPEADMN | ||||||
Compositional bias | 330-402 | Basic and acidic residues | ||||
Sequence: TKTPRDKERERYRERERDRERDRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ005579 EMBL· GenBank· DDBJ | CAA06607.1 EMBL· GenBank· DDBJ | mRNA | ||
AC116353 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC071964 EMBL· GenBank· DDBJ | AAH71964.1 EMBL· GenBank· DDBJ | mRNA | ||
S74221 EMBL· GenBank· DDBJ | AAB32531.1 EMBL· GenBank· DDBJ | mRNA |