Q12893 · TM115_HUMAN
- ProteinTransmembrane protein 115
- GeneTMEM115
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids351 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May play a role in retrograde transport of proteins from the Golgi to the endoplasmic reticulum. May indirectly play a role in protein glycosylation in the Golgi.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi cisterna membrane | |
Cellular Component | Golgi membrane | |
Cellular Component | nucleus | |
Molecular Function | identical protein binding | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | protein transport | |
Biological Process | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTransmembrane protein 115
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ12893
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Golgi apparatus, Golgi stack membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-19 | Cytoplasmic | ||||
Sequence: MQRALPGARQHLGAILASA | ||||||
Transmembrane | 20-40 | Helical; Name=1 | ||||
Sequence: SVVVKALCAAVLFLYLLSFAV | ||||||
Topological domain | 41-97 | Lumenal | ||||
Sequence: DTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALE | ||||||
Transmembrane | 98-118 | Helical; Name=2 | ||||
Sequence: LLIFFSVVNVSVGLLGAFAYL | ||||||
Topological domain | 119-126 | Cytoplasmic | ||||
Sequence: LTYMASFN | ||||||
Transmembrane | 127-147 | Helical; Name=3 | ||||
Sequence: LVYLFTVRIHGALGFLGGVLV | ||||||
Topological domain | 148-165 | Lumenal | ||||
Sequence: ALKQTMGDCVVLRVPQVR | ||||||
Transmembrane | 166-186 | Helical; Name=4 | ||||
Sequence: VSVMPMLLLALLLLLRLATLL | ||||||
Topological domain | 187-351 | Cytoplasmic | ||||
Sequence: QSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 357 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000058451 | 1-351 | UniProt | Transmembrane protein 115 | |||
Sequence: MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYLRFYQRHSRGRGDMADHFAFATFFPEILQPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL | |||||||
Modified residue (large scale data) | 275 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 306 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 314 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 320 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 324 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 329 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 329 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 340 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed strongly in kidney and skeletal muscle, followed by liver, placenta, pancreas, and lung, with low amounts in heart and only traces in brain (PubMed:11085536).
Widely expressed with ubiquitous expression in epithelial tissues (at protein level) (PubMed:17973242).
Widely expressed with ubiquitous expression in epithelial tissues (at protein level) (PubMed:17973242).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homooligomer (PubMed:24806965).
Interacts with COPB1 (PubMed:24806965).
May interact with LMAN1 (PubMed:24806965).
Interacts with the COG complex; probably through COG3 (PubMed:24806965).
Interacts with COPB1 (PubMed:24806965).
May interact with LMAN1 (PubMed:24806965).
Interacts with the COG complex; probably through COG3 (PubMed:24806965).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q12893 | AQP6 Q13520 | 3 | EBI-8633987, EBI-13059134 | |
BINARY | Q12893 | ASPG Q86U10 | 3 | EBI-8633987, EBI-19946665 | |
BINARY | Q12893 | CYB5R3 P00387 | 3 | EBI-8633987, EBI-1046040 | |
BINARY | Q12893 | HTATIP2 Q9BUP3-3 | 3 | EBI-8633987, EBI-12937691 | |
BINARY | Q12893 | HTT P42858 | 3 | EBI-8633987, EBI-466029 | |
BINARY | Q12893 | LAMP2 P13473-2 | 3 | EBI-8633987, EBI-21591415 | |
BINARY | Q12893 | MANBAL Q9NQG1 | 3 | EBI-8633987, EBI-3867271 | |
BINARY | Q12893 | RABAC1 Q9UI14 | 3 | EBI-8633987, EBI-712367 | |
BINARY | Q12893 | SH3GLB1 Q9Y371 | 3 | EBI-8633987, EBI-2623095 | |
BINARY | Q12893 | SYNE4 Q8N205 | 3 | EBI-8633987, EBI-7131783 | |
BINARY | Q12893 | TLCD4 Q96MV1 | 3 | EBI-8633987, EBI-12947623 | |
BINARY | Q12893 | TMED8 Q6PL24 | 3 | EBI-8633987, EBI-11603430 | |
BINARY | Q12893 | TMX2 Q9Y320 | 3 | EBI-8633987, EBI-6447886 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-205 | Mediates homooligomerization | ||||
Sequence: MQRALPGARQHLGAILASASVVVKALCAAVLFLYLLSFAVDTGCLAVTPGYLFPPNFWIWTLATHGLMEQHVWDVAISLTTVVVAGRLLEPLWGALELLIFFSVVNVSVGLLGAFAYLLTYMASFNLVYLFTVRIHGALGFLGGVLVALKQTMGDCVVLRVPQVRVSVMPMLLLALLLLLRLATLLQSPALASYGFGLLSSWVYL | ||||||
Region | 206-229 | Mediates localization to the Golgi | ||||
Sequence: RFYQRHSRGRGDMADHFAFATFFP | ||||||
Region | 301-351 | Disordered | ||||
Sequence: QSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL |
Sequence similarities
Belongs to the TMEM115 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length351
- Mass (Da)38,197
- Last updated1996-11-01 v1
- Checksum8CFBF66322FDEEFC
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U09584 EMBL· GenBank· DDBJ | AAA92281.1 EMBL· GenBank· DDBJ | mRNA | ||
CR457020 EMBL· GenBank· DDBJ | CAG33301.1 EMBL· GenBank· DDBJ | mRNA | ||
AC002481 EMBL· GenBank· DDBJ | AAB67308.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
Z84492 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471055 EMBL· GenBank· DDBJ | EAW65115.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC011948 EMBL· GenBank· DDBJ | AAH11948.1 EMBL· GenBank· DDBJ | mRNA | ||
BC017367 EMBL· GenBank· DDBJ | AAH17367.1 EMBL· GenBank· DDBJ | mRNA |