Q12309 · CLF1_YEAST
- ProteinPre-mRNA-splicing factor CLF1
- GeneCLF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids687 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in pre-mRNA splicing and cell cycle progression. Required for the spliceosome assembly by promoting the functional integration of the U4/U6.U5 tri-snRNP particle into the U1-, U2-dependent pre-spliceosome. Also recruits PRP19 to the spliceosome, as a component of the NTC complex (or PRP19-associated complex). The association of the NTC complex to the spliceosome mediates conformational rearrangement or stabilizes the structure of the spliceosome after U4 snRNA dissociation, which leads to spliceosome maturation. Required for initiation of the DNA replication by binding the RNA replication origins, probably through its interaction with the origin recognition complex (ORC).
Miscellaneous
Present with 2140 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | post-mRNA release spliceosomal complex | |
Cellular Component | Prp19 complex | |
Cellular Component | U2-type catalytic step 1 spliceosome | |
Cellular Component | U2-type catalytic step 2 spliceosome | |
Cellular Component | U2-type post-mRNA release spliceosomal complex | |
Cellular Component | U2-type prespliceosome | |
Molecular Function | chromatin binding | |
Molecular Function | DNA replication origin binding | |
Biological Process | cis assembly of pre-catalytic spliceosome | |
Biological Process | DNA replication initiation | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | spliceosomal complex assembly |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePre-mRNA-splicing factor CLF1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ12309
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000205753 | 1-687 | Pre-mRNA-splicing factor CLF1 | |||
Sequence: MDTLEPTAVDTHVSAEQILRDVYKKGQKARGSTNIDILDLEELREYQRRKRTEYEGYLKRNRLDMGQWIRYAQFEIEQHDMRRARSIFERALLVDSSFIPLWIRYIDAELKVKCINHARNLMNRAISTLPRVDKLWYKYLIVEESLNNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIRQKNWNGVREIYSKYVMAHPQMQTWLKWVRFENRHGNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLVNSFAHWEAAQQEYERSSALYQIAIEKWPSNQLLKAGLLDFEKQFGDINSIEETISYKRKMEYETILSNNAYDYDTWWLYLDLISESFPKQIMQTFEKAIVDSRPKELSKNVQWKRYIYLWMRYICYVELELENSLLEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIRHDDVPKARKILGKAIGLCPKAKTFKGYIELEVKLKEFDRVRKIYEKFIEFQPSDLQIWSQYGELEENLGDWDRVRGIYTIALDENSDFLTKEAKIVLLQKYITFETESQEFEKARKLYRRYLELNQYSPQSWIEFAMYQTSTPTEQQLLDLAKLQSENVDEDIEFEITDENKLEARKVFEEAIVFFKEKDDKQGRLSILEALKDYEETYGTELDQETVKKRFPKVIKKVRLQNGVEEEFVDYIFPDDIDDDKPKPSKFLELAKKWKQEQAL |
Proteomic databases
PTM databases
Interaction
Subunit
Belongs to the NTC complex (or PRP19-associated complex), composed of at least CEF1, CLF1, ISY1, NTC20, SNT309, SYF1, SYF2, and PRP19. The NTC complex associates with the spliceosome after the release of the U1 and U4 snRNAs and forms the CWC spliceosome subcomplex (or CEF1-associated complex) reminiscent of a late-stage spliceosome composed also of the U2, U5 and U6 snRNAs and at least BUD13, BUD31, BRR2, CDC40, CUS1, CWC2, CWC15, CWC21, CWC22, CWC23, CWC24, CWC25, CWC27, ECM2, HSH155, IST3, LEA1, MSL1, PRP8, PRP9, PRP11, PRP21, PRP22, PRP45, PRP46, SLU7, SMB1, SMD1, SMD2, SMD3, SMX2, SMX3, SNU114, SPP2, RSE1 and YJU2. Interacts with CEF1, ISY1, MUD2, NTC20, PRP22, PRP40, PRP46, SYF1, SYF2, and the ORC2 subunit of the origin recognition complex.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q12309 | CEF1 Q03654 | 9 | EBI-484, EBI-476 | |
BINARY | Q12309 | ISY1 P21374 | 5 | EBI-484, EBI-9382 | |
BINARY | Q12309 | NTC20 P38302 | 7 | EBI-484, EBI-20921 | |
BINARY | Q12309 | PRP19 P32523 | 10 | EBI-484, EBI-493 | |
BINARY | Q12309 | SNT309 Q06091 | 5 | EBI-484, EBI-818 | |
BINARY | Q12309 | SYF1 Q04048 | 5 | EBI-484, EBI-540 | |
BINARY | Q12309 | SYF2 P53277 | 3 | EBI-484, EBI-23308 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 45-77 | HAT 1 | ||||
Sequence: EYQRRKRTEYEGYLKRNRLDMGQWIRYAQFEIE | ||||||
Repeat | 79-111 | HAT 2 | ||||
Sequence: HDMRRARSIFERALLVDSSFIPLWIRYIDAELK | ||||||
Repeat | 113-145 | HAT 3 | ||||
Sequence: KCINHARNLMNRAISTLPRVDKLWYKYLIVEES | ||||||
Repeat | 147-178 | HAT 4 | ||||
Sequence: NNVEIVRSLYTKWCSLEPGVNAWNSFVDFEIR | ||||||
Repeat | 180-211 | HAT 5 | ||||
Sequence: KNWNGVREIYSKYVMAHPQMQTWLKWVRFENR | ||||||
Repeat | 213-247 | HAT 6 | ||||
Sequence: GNTEFTRSVYSLAIDTVANLQNLQIWSDMEVAKLV | ||||||
Repeat | 251-283 | HAT 7 | ||||
Sequence: AHWEAAQQEYERSSALYQIAIEKWPSNQLLKAG | ||||||
Repeat | 300-332 | HAT 8 | ||||
Sequence: TISYKRKMEYETILSNNAYDYDTWWLYLDLISE | ||||||
Repeat | 337-369 | HAT 9 | ||||
Sequence: QIMQTFEKAIVDSRPKELSKNVQWKRYIYLWMR | ||||||
Repeat | 383-416 | HAT 10 | ||||
Sequence: LEEELFQRLIDDIIPHKHFTFSKIWLMYAKFLIR | ||||||
Repeat | 451-483 | HAT 11 | ||||
Sequence: KEFDRVRKIYEKFIEFQPSDLQIWSQYGELEEN | ||||||
Repeat | 525-557 | HAT 12 | ||||
Sequence: QEFEKARKLYRRYLELNQYSPQSWIEFAMYQTS | ||||||
Repeat | 629-661 | HAT 13 | ||||
Sequence: LDQETVKKRFPKVIKKVRLQNGVEEEFVDYIFP |
Sequence similarities
Belongs to the crooked-neck family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length687
- Mass (Da)82,445
- Last updated1996-11-01 v1
- ChecksumAE7D5EC5B3979E00
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X89514 EMBL· GenBank· DDBJ | CAA61696.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U53877 EMBL· GenBank· DDBJ | AAB82364.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z73289 EMBL· GenBank· DDBJ | CAA97685.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006945 EMBL· GenBank· DDBJ | DAA09431.1 EMBL· GenBank· DDBJ | Genomic DNA |