Q12266 · YB11A_YEAST
- ProteinTransposon Ty1-BL Gag polyprotein
- GeneTY1A-BL
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids440 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Capsid protein (CA) is the structural component of the virus-like particle (VLP), forming the shell that encapsulates the retrotransposons dimeric RNA genome. The particles are assembled from trimer-clustered units and there are holes in the capsid shells that allow for the diffusion of macromolecules. CA has also nucleocapsid-like chaperone activity, promoting primer tRNA(i)-Met annealing to the multipartite primer-binding site (PBS), dimerization of Ty1 RNA and initiation of reverse transcription (By similarity).
Miscellaneous
Retrotransposons are mobile genetic entities that are able to replicate via an RNA intermediate and a reverse transcription step. In contrast to retroviruses, retrotransposons are non-infectious, lack an envelope and remain intracellular. Ty1 retrotransposons belong to the copia elements (pseudoviridae).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 401-402 | Cleavage; by Ty1 protease | ||||
Sequence: HN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | RNA binding | |
Biological Process | viral translational frameshifting |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameTransposon Ty1-BL Gag polyprotein
- Alternative names
- Cleaved into 2 chains
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ12266
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000278991 | 1-401 | Capsid protein | |||
Sequence: MESQQLSQHSPIFHGSACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQANISGWPVYGHPSLMPYPPYQMSPMYAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPNDFLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPPWVKDILSVDYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNNGIPINNKVACQFIMRGLSGEYKFLPYARHRCIHMTVADLFSDIHSMYEEQQESKRNKSTYRRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAH | ||||||
Chain | PRO_0000278990 | 1-440 | Transposon Ty1-BL Gag polyprotein | |||
Sequence: MESQQLSQHSPIFHGSACASVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPSSAVPENHHHASPQAAQVPLPQNGPYPQQRMMNTQQANISGWPVYGHPSLMPYPPYQMSPMYAPPGAQSQFTQYPQYVGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPPILTSPNDFLNWVKIYIKFLQNSNLGDIIPTATRKAVRQMTDDELTFLCHTFQLFAPSQFLPPWVKDILSVDYTDIMKILSKSINKMQSDTQEVNDITTLATLHYNGSTPADAFEAEVTNILDRLNNNGIPINNKVACQFIMRGLSGEYKFLPYARHRCIHMTVADLFSDIHSMYEEQQESKRNKSTYRRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGSTTEPIQLKNTHDLHLRPGTY | ||||||
Peptide | PRO_0000278992 | 402-440 | Gag-p4 | |||
Sequence: NVSTFNNSPGPDNDLIRGSTTEPIQLKNTHDLHLRPGTY |
Proteomic databases
PTM databases
Expression
Induction
Ty1-BL is a highly expressed element. Induced under amino acid starvation conditions by GCN4.
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 20-67 | Polar residues | ||||
Sequence: SVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPSSAVPENH | ||||||
Region | 20-84 | Disordered | ||||
Sequence: SVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPSSAVPENHHHASPQAAQVPLPQNGP | ||||||
Region | 137-173 | Disordered | ||||
Sequence: VGTHLNTPSPESGNSFPDSSSAKSNMTSTNQHVRPPP | ||||||
Region | 299-401 | RNA-binding | ||||
Sequence: NNGIPINNKVACQFIMRGLSGEYKFLPYARHRCIHMTVADLFSDIHSMYEEQQESKRNKSTYRRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAH | ||||||
Compositional bias | 350-375 | Basic and acidic residues | ||||
Sequence: QQESKRNKSTYRRSPSDEKKDSRTYT | ||||||
Region | 350-424 | Disordered | ||||
Sequence: QQESKRNKSTYRRSPSDEKKDSRTYTNTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGSTTEP | ||||||
Compositional bias | 376-424 | Polar residues | ||||
Sequence: NTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGSTTEP |
Domain
The C-terminal RNA-binding region of CA is sufficient for all its nucleocapsid-like chaperone activities.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Ribosomal frameshifting. The Gag-Pol polyprotein is generated by a +1 ribosomal frameshift. The ratio of Gag:Gag-Pol varies between 20:1 and 5:1 (By similarity).
Q12266-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameTransposon Ty1-BL Gag polyprotein
- NoteProduced by conventional translation.
- Length440
- Mass (Da)49,285
- Last updated1996-11-01 v1
- ChecksumEBE246012C88C029
Q12490-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- NameTransposon Ty1-BL Gag-Pol polyprotein
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 20-67 | Polar residues | ||||
Sequence: SVTSKEVQTTQDPLDISASKTEECEKVSTQANSQQPTTPPSSAVPENH | ||||||
Compositional bias | 350-375 | Basic and acidic residues | ||||
Sequence: QQESKRNKSTYRRSPSDEKKDSRTYT | ||||||
Compositional bias | 376-424 | Polar residues | ||||
Sequence: NTTKPKSITRNSQKPNNSQSRTARAHNVSTFNNSPGPDNDLIRGSTTEP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z35765 EMBL· GenBank· DDBJ | CAA84819.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z35766 EMBL· GenBank· DDBJ | CAA84823.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006936 EMBL· GenBank· DDBJ | DAA07117.1 EMBL· GenBank· DDBJ | Genomic DNA |