Q12234 · RUD3_YEAST
- ProteinGRIP domain-containing protein RUD3
- GeneRUD3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids484 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Involved in the structural organization of the cis-Golgi and in vesicle targeting/fusion stages of ER to Golgi transport.
Miscellaneous
Present with 7620 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Cellular Component | Golgi lumen | |
Cellular Component | Golgi membrane | |
Molecular Function | GTPase binding | |
Molecular Function | small GTPase binding | |
Biological Process | endoplasmic reticulum to Golgi vesicle-mediated transport | |
Biological Process | Golgi organization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGRIP domain-containing protein RUD3
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ12234
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: The Golgi localization needs the presence of ARF1 and ERV14.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000268739 | 1-484 | GRIP domain-containing protein RUD3 | |||
Sequence: MGKNKKKTGKKAKSHPHVEDVDETVNKPEEIINSVNVTVPPKMSTDPEADGIVASPDDEGKDLSEGVDKQKVNDGLTVDTINPLEDKKAGDEMKELREEIERLKLELSHKKDQETPNEDFKNELANVIKERDEFKTQYDTLLSKISSMKSIFNKMKEAQKQLEEVQEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNTELENLEKEQESTEEVFLEYESRIEALEDEKHDIIEKHSKELNTYRKEKDQLNLQVQELMIILENNKQDISDLRTERDELRQALESHEKEKAVLKNSLNDLELKIEEVDNKREEEARERDQEVKSLRSQLDTEIETHNNDTEALESMKKQLEAMKEDASMKEKYEEESKQHILQIGKLRHEAIILNEHLTKALAMLKKSSDSESVDKELISNLLISFVSIPRADPRKFEVLELLSNFLNWDEDKKQQAGLISNNESKNSSAVSRTESFVSLWTNYLEKESEKD | ||||||
Modified residue | 55 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 64 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 468 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q12234 | ARF1 P11076 | 5 | EBI-31697, EBI-2816 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-75 | Disordered | ||||
Sequence: MGKNKKKTGKKAKSHPHVEDVDETVNKPEEIINSVNVTVPPKMSTDPEADGIVASPDDEGKDLSEGVDKQKVNDG | ||||||
Compositional bias | 13-27 | Basic and acidic residues | ||||
Sequence: KSHPHVEDVDETVNK | ||||||
Compositional bias | 54-69 | Basic and acidic residues | ||||
Sequence: ASPDDEGKDLSEGVDK | ||||||
Coiled coil | 84-383 | |||||
Sequence: LEDKKAGDEMKELREEIERLKLELSHKKDQETPNEDFKNELANVIKERDEFKTQYDTLLSKISSMKSIFNKMKEAQKQLEEVQEQLTEYESQNLKLKKKLEATKTENSELQSTIVTLNTELENLEKEQESTEEVFLEYESRIEALEDEKHDIIEKHSKELNTYRKEKDQLNLQVQELMIILENNKQDISDLRTERDELRQALESHEKEKAVLKNSLNDLELKIEEVDNKREEEARERDQEVKSLRSQLDTEIETHNNDTEALESMKKQLEAMKEDASMKEKYEEESKQHILQIGKLRHEA | ||||||
Domain | 401-452 | GRIP | ||||
Sequence: SDSESVDKELISNLLISFVSIPRADPRKFEVLELLSNFLNWDEDKKQQAGLI |
Domain
The GRIP domain binds to ARF1, which leads to the Golgi localization of RUD3.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length484
- Mass (Da)56,069
- Last updated1996-11-01 v1
- ChecksumC08492A0F2760AD4
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 13-27 | Basic and acidic residues | ||||
Sequence: KSHPHVEDVDETVNK | ||||||
Compositional bias | 54-69 | Basic and acidic residues | ||||
Sequence: ASPDDEGKDLSEGVDK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X92441 EMBL· GenBank· DDBJ | CAA63179.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z75124 EMBL· GenBank· DDBJ | CAA99433.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006948 EMBL· GenBank· DDBJ | DAA10988.1 EMBL· GenBank· DDBJ | Genomic DNA |