Q12154 · GET3_YEAST
- ProteinATPase GET3
- GeneGET3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids354 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors GET1 and GET2, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the GET1-GET2 receptor, and returning it to the cytosol to initiate a new round of targeting. Cooperates with the HDEL receptor ERD2 to mediate the ATP-dependent retrieval of resident ER proteins that contain a C-terminal H-D-E-L retention signal from the Golgi to the ER. Involved in low-level resistance to the oxyanions arsenite and arsenate, and in heat tolerance.
Miscellaneous
Present with 17300 molecules/cell in log phase SD medium.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 26-33 | ATP (UniProtKB | ChEBI) | ||||
Sequence: KGGVGKTT | ||||||
Active site | 57 | |||||
Sequence: D | ||||||
Binding site | 245 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 272 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 285 | Zn2+ (UniProtKB | ChEBI); ligand shared between dimeric partners | ||||
Sequence: C | ||||||
Binding site | 288 | Zn2+ (UniProtKB | ChEBI); ligand shared between dimeric partners | ||||
Sequence: C | ||||||
Binding site | 315-322 | ATP (UniProtKB | ChEBI) | ||||
Sequence: PLCAGEIR |
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameATPase GET3
- EC number
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ12154
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: GET1 and GET2 are required for targeting GET3 to the endoplasmic reticulum.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 30 | Abolishes ATPase activity, leading to secretion of resident ER proteins. | ||||
Sequence: G → R | ||||||
Mutagenesis | 57 | Abolishes ATP hydrolysis. | ||||
Sequence: D → N | ||||||
Mutagenesis | 285 | Prevents dimerization; when associated with S-288. | ||||
Sequence: C → S | ||||||
Mutagenesis | 288 | Prevents dimerization; when associated with S-285. | ||||
Sequence: C → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 4 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000152256 | 1-354 | ATPase GET3 | |||
Sequence: MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE |
Proteomic databases
PTM databases
Interaction
Subunit
Homodimer. Component of the Golgi to ER traffic (GET) complex, which is composed of GET1, GET2 and GET3. Within the complex, GET1 and GET2 form a heterotetramer which is stabilized by phosphatidylinositol binding and which binds to the GET3 homodimer (PubMed:32910895).
Interacts with the chloride channel protein GEF1
Interacts with the chloride channel protein GEF1
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q12154 | GEF1 P37020 | 6 | EBI-2989, EBI-7552 | |
BINARY | Q12154 | GET1 P53192 | 13 | EBI-2989, EBI-23722 | |
BINARY | Q12154 | GET2 P40056 | 10 | EBI-2989, EBI-22604 | |
BINARY | Q12154 | GET3 Q12154 | 12 | EBI-2989, EBI-2989 | |
BINARY | Q12154 | GET4 Q12125 | 11 | EBI-2989, EBI-36940 | |
BINARY | Q12154 | MDY2 Q12285 | 10 | EBI-2989, EBI-34904 | |
BINARY | Q12154 | NYV1 Q12255 | 3 | EBI-2989, EBI-35465 | |
BINARY | Q12154 | PEP12 P32854 | 5 | EBI-2989, EBI-13098 | |
BINARY | Q12154 | SEC22 P22214 | 7 | EBI-2989, EBI-16577 | |
XENO | Q12154 | SEC61B P60468 | 4 | EBI-2989, EBI-1788819 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length354
- Mass (Da)39,354
- Last updated1996-11-01 v1
- ChecksumF795C359B5A4A461
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 43 | in Ref. 4; AAT93183 | ||||
Sequence: A → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X95644 EMBL· GenBank· DDBJ | CAA64913.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z74148 EMBL· GenBank· DDBJ | CAA98667.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY693164 EMBL· GenBank· DDBJ | AAT93183.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA11760.1 EMBL· GenBank· DDBJ | Genomic DNA |