Q10KX8 · HFB4D_ORYSJ
- ProteinHeat stress transcription factor B-4d
- GeneHSFB4D
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids305 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHeat stress transcription factor B-4d
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ10KX8
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000350840 | 1-305 | Heat stress transcription factor B-4d | |||
Sequence: MAFLVERCGGEMVVSMERSHGRSTTTAAAVTAAPAPFLSKTYQLVDDPSTDDVVSWGEDEATFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYGFRKIVADRWEFANEFFRKGAKHLLSEIHRRKSSSCSQPQPPPPFPMHQHYPLSLFSPPTTPRSPPVGAAAAAAYHFQEEYCSSPADYAGGGGDLLAALSEDNRQLRRRNSLLLSELAHMRKLYNDIIYFLQNHVEPVAPPPLAAATSCRLVELGPSTTERRRCAASPSGDNDDDAAVRLFGVRLDDDHGKKRRVQLVQEDEGDEQGSEG |
Post-translational modification
Exhibits temperature-dependent phosphorylation.
Keywords
- PTM
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 201-230 | Hydrophobic repeat HR-A/B | ||||
Sequence: LRRRNSLLLSELAHMRKLYNDIIYFLQNHV | ||||||
Motif | 286-289 | Nuclear localization signal | ||||
Sequence: KKRR | ||||||
Region | 286-305 | Disordered | ||||
Sequence: KKRRVQLVQEDEGDEQGSEG |
Domain
The hydrophobic-rich region (HR-A/B) corresponds to the oligomerization domain.
Sequence similarities
Belongs to the HSF family. Class B subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length305
- Mass (Da)33,951
- Last updated2006-08-22 v1
- ChecksumD753A19BC28D715B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000009 EMBL· GenBank· DDBJ | ABF96133.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008209 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP014959 EMBL· GenBank· DDBJ | BAS84326.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000140 EMBL· GenBank· DDBJ | EEE59109.1 EMBL· GenBank· DDBJ | Genomic DNA |