Q10953 · WRM1_CAEEL
- ProteinArmadillo repeat-containing protein wrm-1
- Genewrm-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids796 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Antagonistic role in the Wnt signaling pathway that operates in embryogenesis. When located at the cortex it has been shown to inhibit Wnt signaling during asymmetric cell division but when relocated to the nucleus it shows positive regulation. Has a role in blastomere signaling during endoderm specification. Component of the beta-catenin-lit-1 complex which promotes phosphorylation, down-regulation and subcellular relocation of pop-1 (PubMed:10380924).
Within the complex, activates lit-1-dependent kinase activity (PubMed:10380924).
Can substitute for bar-1 indicating functional redundancy. Appears to have a role in centrosome positioning and can activation transcription in yeast. Involved in the development of distal tip cells (DTC) by regulating the asymmetric distribution of cye-1 and cki-1 between the daughters of Z1.a and Z4.p cells (PubMed:17476329).
Within the complex, activates lit-1-dependent kinase activity (PubMed:10380924).
Can substitute for bar-1 indicating functional redundancy. Appears to have a role in centrosome positioning and can activation transcription in yeast. Involved in the development of distal tip cells (DTC) by regulating the asymmetric distribution of cye-1 and cki-1 between the daughters of Z1.a and Z4.p cells (PubMed:17476329).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameArmadillo repeat-containing protein wrm-1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ10953
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Located in the anterior cell cortex before and during asymmetric cell division. After division, located preferentially in the nucleus of the posterior daughter cell.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Worms exhibit premature cell cleavage during embryogenesis, symmetrical cell division during gonadogenesis and undifferentiated intestines. Embryos show a defect in centrosome positioning that delays ABar spindle alignment and appear to lack endoderm.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000342701 | 1-796 | Armadillo repeat-containing protein wrm-1 | |||
Sequence: MDVDCAETFSQPCTPLNFNPMTPSTSRVSTPVRPSSTMSARQYSGSPFKAQPQNMEPSNSRVQELREAAVGKRSYTNAWMQGTYAPPQMAGQQQRFSRPPSVIGSTMSHMTNMSEMTAYSYGGLSMLSVNTEMGEFNNFVNQAPYQRALTRVSQVSENQDPTNRQYPMTAPEIIENLESTELINQAAAIRALEPIVKAGGMLQTWGPKGAEPIIRALFQVLIPRPVENENVIRKAFEILHHSILLSNKEIRRIDRMFFRLNAALMDPNGPPVFNVPKPYSIYEIVMTRAIQLDTKFESSAMVLLVHLCCKPHFMKIFFGEDETQQSPAHRRLHKIVIEFAIGNLRRPETKSKNKGLCVSIIKNLSNKNATIKDMSERLGVVSLFHQIMQNEVIHEDLLWSTMQALTVFCGDVKNGTHFVQMGGAQVLCGLLSHGSTRLLHELLKCLRRVSDLPAIQEQDMKESIHCIVQLIGCSDVTIVELATGTLRNIGLHNKMNKAFMVQDGVTSHAIAVLRTSEQFTYQPHANIDLYRKQILSIYENCLSVLNNVTSMAPQDIKESAVSACRMISENADSAYVLLHYFNVGNRKCRKLAVTVMKRVIETVPAFADPFVDLLGTTNEPLPILLLQRAFQSLDEWRKTSVEMMNCDGRSAEQRRELDDRRKDHEDIVKRSVGLLTNLCSQANPRFFHSLKLVLTNGTLNPFQWLTHEMSDGILQEWLAFILSICSRDESLQTFMMYRFLEQAKMTEAFFAELKARRQNSNIQTMLSKIIDLGRHQQRIVSQQHQQHQMQHHRQLM |
Proteomic databases
Interaction
Subunit
Interacts (independently of ARM repeat) with nhr-25 (PubMed:16890160).
Component of the beta-catenin-lit-1 complex (also called the lit-1/wrm-1 complex or the wrm-1/lit-1 kinase complex) at least composed of lit-1 and wrm-1 (PubMed:10380924, PubMed:15066285).
Interacts (via N-terminus) with lit-1; the interaction is direct and activates lit-1 kinase activity which leads to the phosphorylation of pop-1 (PubMed:10380924, PubMed:11560894, PubMed:15066285).
This promotes pop-1 interaction with par-5 and translocation of pop-1 from the nucleus to the cytoplasm (PubMed:15066285).
Component of the beta-catenin-lit-1 complex (also called the lit-1/wrm-1 complex or the wrm-1/lit-1 kinase complex) at least composed of lit-1 and wrm-1 (PubMed:10380924, PubMed:15066285).
Interacts (via N-terminus) with lit-1; the interaction is direct and activates lit-1 kinase activity which leads to the phosphorylation of pop-1 (PubMed:10380924, PubMed:11560894, PubMed:15066285).
This promotes pop-1 interaction with par-5 and translocation of pop-1 from the nucleus to the cytoplasm (PubMed:15066285).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q10953 | lit-1 Q9U9Y8 | 8 | EBI-2530558, EBI-318513 | |
BINARY | Q10953 | nhr-25 Q19345 | 3 | EBI-2530558, EBI-3871243 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 17-59 | Disordered | ||||
Sequence: NFNPMTPSTSRVSTPVRPSSTMSARQYSGSPFKAQPQNMEPSN | ||||||
Repeat | 462-504 | ARM | ||||
Sequence: ESIHCIVQLIGCSDVTIVELATGTLRNIGLHNKMNKAFMVQDG |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length796
- Mass (Da)90,349
- Last updated2001-06-01 v2
- ChecksumB517C7A804A7DEA8
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0K3AUT2 | A0A0K3AUT2_CAEEL | wrm-1 | 742 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF013951 EMBL· GenBank· DDBJ | AAC47748.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284603 EMBL· GenBank· DDBJ | CCD61515.1 EMBL· GenBank· DDBJ | Genomic DNA |