Q10924 · FKH6_CAEEL
- ProteinForkhead transcription factor fkh-6
- Genefkh-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids323 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Probable transcription factor (PubMed:14993191, PubMed:20553900).
Binds to the DNA sequence motif 5'-[TA]TGTT[TG]T[TG][ATG]TT-3' (PubMed:20553900).
Regulates sexual dimorphism in the gonad, promoting male gonadal cell fates in chromosomally (XO) male animals, yet plays a role in gonadogenesis in both sexes; probably acts downstream of terminal regulator of sex determination tra-1, to control early gonadogenesis (PubMed:14993191).
Positively modulates expression of homeobox protein egl-5, probably acting indirectly, during early gonadal development (PubMed:20553900).
Binds to the DNA sequence motif 5'-[TA]TGTT[TG]T[TG][ATG]TT-3' (PubMed:20553900).
Regulates sexual dimorphism in the gonad, promoting male gonadal cell fates in chromosomally (XO) male animals, yet plays a role in gonadogenesis in both sexes; probably acts downstream of terminal regulator of sex determination tra-1, to control early gonadogenesis (PubMed:14993191).
Positively modulates expression of homeobox protein egl-5, probably acting indirectly, during early gonadal development (PubMed:20553900).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 21-122 | Fork-head | ||||
Sequence: KPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYWQMVADNAPQFDNGNFKRRRV |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | anatomical structure morphogenesis | |
Biological Process | cell differentiation | |
Biological Process | gonad development | |
Biological Process | male germ-line sex determination | |
Biological Process | male gonad development | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameForkhead transcription factor fkh-6
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ10924
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 1 | In ez16; defects in gonad morphology; failure to elongate normally and feminization of male (X0) gonad, such as developing a vulva, are the most drastic and most frequent abnormalities. Hermaphrodites are infertile. Abolishes expression of homeobox egl-5 in somatic gonadal precursor cells, Z1 and Z4, during larval L1 stage. | ||||
Sequence: M → I |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000454565 | 1-323 | Forkhead transcription factor fkh-6 | |||
Sequence: MTRHQTHLPFHIVQEGNSIDKPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLNDCFVKKARDGQSCANDRKGNYWQMVADNAPQFDNGNFKRRRVKRLGIGKMGYANTTETTETGTILQQQLPFFNGLKWPQNIQTMDPFQFFKFQYPNSITDSANTSQINNSSSSSSSFDTSIYTSAFPIPTSHFDTNLVAPSQPPPVVSDVEVVPSDTVKEEVLVDMKPLIPGISSTTFLTSLQMTDPRSIEQQQLLSTASNMYPNAFMPPYTNWSCQPTTTFTGLSFDDPSLYGYGQQFPASS |
Proteomic databases
Structure
Sequence
- Sequence statusComplete
- Length323
- Mass (Da)36,421
- Last updated1996-11-01 v1
- Checksum00A2BA04326ACA2A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284602 EMBL· GenBank· DDBJ | CCD61668.1 EMBL· GenBank· DDBJ | Genomic DNA |