Q10585 · SPD1_SCHPO
- ProteinS-phase delaying protein 1
- Genespd1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids124 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates the ribonucleotide reductase activity through its mediation of the nuclear localization of suc22, the small subunit of the ribonucleotide reductase. Delays the progression of the G1-S phase transition, thereby ensuring the G1 phase is complete. Interacts with both p34 and the p34-p56 complex, although no direct inhibitory effect on the bound proteins has been demonstrated. The action of p14 may happen coincidentally with the cdc10 function or may happen downstream of this.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | nucleus | |
Molecular Function | protein-containing complex binding | |
Molecular Function | protein-membrane adaptor activity | |
Molecular Function | ribonucleoside-diphosphate reductase inhibitor activity | |
Biological Process | cell division | |
Biological Process | dCDP biosynthetic process | |
Biological Process | protein localization |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameS-phase delaying protein 1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionQ10585
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000072110 | 1-124 | S-phase delaying protein 1 | |||
Sequence: MHSSKRVMTTKTHVEQPESSMRPQLPESIQGSLMDVGMRVRKSISTGYKSKQTTFPAYNPPLYNTVSENIALKNTAFSYEPNGTKRPFEQAIPNYNWANPPQDFEEPEWLKPFDVVMEGTNERL |
Post-translational modification
Ubiquitinated by the DCX(DTL) complex, also named CRL4(CDT2) complex, leading to its degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
The levels peak in the G1 phase of the cell cycle, then mostly disappear during S phase and reappear in the G2 phase.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-32 | Disordered | ||||
Sequence: MHSSKRVMTTKTHVEQPESSMRPQLPESIQGS | ||||||
Compositional bias | 13-27 | Polar residues | ||||
Sequence: HVEQPESSMRPQLPE |
Sequence similarities
Belongs to the DIF1/spd1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length124
- Mass (Da)14,225
- Last updated1996-11-01 v1
- ChecksumF43A6C9D86F55F51
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 13-27 | Polar residues | ||||
Sequence: HVEQPESSMRPQLPE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X98361 EMBL· GenBank· DDBJ | CAA67006.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CU329670 EMBL· GenBank· DDBJ | CAB16248.1 EMBL· GenBank· DDBJ | Genomic DNA |