Q10480 · PNU1_SCHPO
- ProteinNuclease 1, mitochondrial
- Genepnu1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids322 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
This enzyme has both RNase and DNase activity. It degrades single-stranded DNA and RNA.
Miscellaneous
The active site contains 1 hydrated divalent metal cation that has only 1 direct interaction with the protein; all other interactions are via water molecules.
Cofactor
Mg2+ (UniProtKB | Rhea| CHEBI:18420 )
Features
Showing features for active site, binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrion | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase I complex | |
Molecular Function | DNA endonuclease activity | |
Molecular Function | DNA nuclease activity | |
Molecular Function | metal ion binding | |
Molecular Function | nucleic acid binding | |
Molecular Function | RNA endonuclease activity | |
Molecular Function | RNA nuclease activity | |
Molecular Function | single-stranded DNA endodeoxyribonuclease activity | |
Biological Process | mitochondrial DNA catabolic process | |
Biological Process | mitochondrial RNA catabolic process | |
Biological Process | transcription elongation by RNA polymerase I |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclease 1, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionQ10480
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, transit peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000019921 | ?-322 | Nuclease 1, mitochondrial | |||
Sequence: MSSNLIKSFGLIAIGAISGVTFTHFYYKGYQGSDVPDLTPRYTKFDSAGRALESIYDFNATKFFQYGIPGPVADQRVNHGYMSVFDRRTRNPFYTAETITQESLNQRKGNRRYSEFVPDDNIPEMFQAKLGDYRGSGYDRGHQVPAADCKFSQEAMNETFYLSNMCPQVGDGFNRNYWAYFEDWCRRLTSKYGSVTIMTGPLYLPKKNERGQWEVQYRVIGNPPNVAVPTHFFKVIIAEKSGEPTSSPSVAAFVLPNKPIADNFPLKNFAVPVEVVERASGLEILSNVPKGNRKQLCSEVVCQLNVKEFVESVKQKQKNQGK | ||||||
Transit peptide | 1-? | Mitochondrion |
Proteomic databases
PTM databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length322
- Mass (Da)36,428
- Last updated2003-05-16 v2
- ChecksumC3AB9C38801563A5
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 321-322 | in Ref. 2; CAA97354 | ||||
Sequence: GK → VFLVFPVIVLYYENI |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB050780 EMBL· GenBank· DDBJ | BAB20882.1 EMBL· GenBank· DDBJ | mRNA | ||
CU329670 EMBL· GenBank· DDBJ | CAA97354.2 EMBL· GenBank· DDBJ | Genomic DNA |