Q10197 · ALP1_SCHPO
- ProteinTubulin-folding cofactor D
- Genealp1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids1105 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has a function in the folding of beta-tubulin. Microtubule-associated protein that is essential to direct polarized cell growth and to position the nucleus and septum to the center of the cell during mitosis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell division site | |
Cellular Component | cytosol | |
Cellular Component | microtubule | |
Cellular Component | microtubule cytoskeleton | |
Cellular Component | mitotic spindle | |
Cellular Component | nucleus | |
Cellular Component | tubulin folding cofactor complex | |
Molecular Function | beta-tubulin binding | |
Molecular Function | GTPase activator activity | |
Molecular Function | protein folding chaperone | |
Biological Process | cytoplasmic microtubule organization | |
Biological Process | microtubule cytoskeleton organization | |
Biological Process | post-chaperonin tubulin folding pathway | |
Biological Process | protein folding | |
Biological Process | tubulin complex assembly |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameTubulin-folding cofactor D
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Taphrinomycotina > Schizosaccharomycetes > Schizosaccharomycetales > Schizosaccharomycetaceae > Schizosaccharomyces
Accessions
- Primary accessionQ10197
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Microtubule-associated.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000064568 | 1-1105 | Tubulin-folding cofactor D | |||
Sequence: MEEEESLEGIISIDESLITSRLSQILDDVLDDRSSSHSVEKLKDVAVKYLQFCQFQPTLLDKLLSKYVPNLASYLLKVKNIGKCNSITVILYQFCKIRGYKAVRVLFPVGVQYIKELYTLLNESSNNTWHFHYIVLLWLSQALNTPFPLNSLDDSLDVKKTIYTIAIKYLENSGIDKEASCLVLSRLFSRDDGLDLLLGFLHHCESSWFKRSIFYKIGCLFSLSSFLKICPRNDCLQTVDVAFQFLNVAREDLVGQENSALRKLLCKCYTRLGIVLLPVNSSPNWKYSISNPDSFFQLPDDSNEEVHIYLEVIVDFLLSSVSDIDSFVRWSAAKGLAKIISRLPWNLAEQVIDAIIELMTENMFLNPIENTVNISITSPLVWHGAILFFAKLAGAGLIKYSKCLHILPLIEVGLSYEVRYGTRVTGQSIRDASCYFVWSFYHCYSKSAIEGLQTNLILCLLQTVLFDNEINVRRAATAALFEVIGRHASIPDGLSLISHINYVSVTDISNCYGDLCMKVAHFPQFRSCVFQRLFTNLQHWDVKVQQLSAFSLRQLSIKYPKELSIYLPPILDYLSVGNADFIFGYTIGLASIIGGFLSISFPFDINRIHDLLSHKNLLSLKKFSRQQQTKIILGILKGIQQIFANDIRVDRAFFSEAFSVIIAAIDLQEETIIKDISDAYSVLVKFDDMEETLEVLLDYIRKCSTSKEARIVYIILQNLPNISFRYQKKICKLLLDIYPQLHSIDYQAPVANALQNIIPFTYEKTESIEEFVKELLQVCSNYLTDTRGDVGSWIRKPAMKAISSLLVKDSSGKKLSEDIVWCCISYIIRQTFDKIDSLRGLAYQALEQIRVHYLIRRCEALTNIINRIRNNPNMDGEVLNELNISLLEIPNLRLQAFYGITVFTADGFGSDLAVKCFEFYLSYVYQLEDSFKKSNSRYGKRDLLQLYIDILSSEDEIARFYFPIMKSFTSLLAYGCFTDFQNVKGMSKAIFIVQRRALTCKSPGGLSAILELYRTLFLSKNELLRHHALKYTANLLLNPIEKVRYQAADTLLYAKSIGLLTFLPNELNQKLLTLDWFVPVSQNATFVKQLRNIIQKQIDKLIADR | ||||||
Glycosylation | 122 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 126 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 373 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 721 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 883 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 1083 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 308-345 | HEAT 1 | ||||
Sequence: IYLEVIVDFLLSSVSDIDSFVRWSAAKGLAKIISRLPW | ||||||
Repeat | 347-385 | HEAT 2 | ||||
Sequence: LAEQVIDAIIELMTENMFLNPIENTVNISITSPLVWHGA | ||||||
Repeat | 401-446 | HEAT 3 | ||||
Sequence: SKCLHILPLIEVGLSYEVRYGTRVTGQSIRDASCYFVWSFYHCYSK | ||||||
Repeat | 452-489 | HEAT 4 | ||||
Sequence: LQTNLILCLLQTVLFDNEINVRRAATAALFEVIGRHAS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,105
- Mass (Da)126,274
- Last updated2012-10-03 v3
- Checksum437AF21F25DE60E7
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 988-1001 | in Ref. 2; CAA20686 | ||||
Sequence: Missing |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y10106 EMBL· GenBank· DDBJ | CAA71193.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CU329671 EMBL· GenBank· DDBJ | CAA20686.2 EMBL· GenBank· DDBJ | Genomic DNA |