Q0V967 · FBX5_DANRE
- ProteinF-box only protein 5
- Genefbxo5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids384 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
During embryonic development, regulates the integrity of the genome and therefore the cell cycle progression by preventing rereplication through an APC-Cdh1-dependent mechanism.
Pathway
Protein modification; protein ubiquitination.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 315 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 318 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 333 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 338 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 343 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 346 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 351 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 356 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | spindle | |
Molecular Function | ubiquitin ligase inhibitor activity | |
Molecular Function | zinc ion binding | |
Biological Process | cell division | |
Biological Process | chromosome organization | |
Biological Process | hemopoiesis | |
Biological Process | mitotic cell cycle | |
Biological Process | mitotic cytokinesis | |
Biological Process | negative regulation of meiotic nuclear division | |
Biological Process | negative regulation of mitotic nuclear division | |
Biological Process | negative regulation of ubiquitin protein ligase activity | |
Biological Process | protein ubiquitination | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of mitotic cell cycle | |
Biological Process | regulation of mitotic nuclear division |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameF-box only protein 5
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ0V967
- Secondary accessions
Proteomes
Organism-specific databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 155-384 | In hrpti245; abnormal bumpy head accompanied by a shortened body axis of the embryo. During embryonic development, mutants are slightly smaller and show little or no growth thereafter. Induces rereplication and mitosis cessation. | ||||
Sequence: Missing | ||||||
Mutagenesis | 159 | In hrpx1; recessive allele that is lethal and induces a reduction of neurons number but with an increase of size. Induces rereplication and mitosis cessation. | ||||
Sequence: T → A | ||||||
Mutagenesis | 162 | In hrpx1; recesive allele that is lethal and induces a reduction of neurons number but with an increase of size. Induces rereplication and mitosis cessation. | ||||
Sequence: D → N |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000258009 | 1-384 | F-box only protein 5 | |||
Sequence: MKCPNYTEDSTVLCHMEKTETDLGEVKGHKVSPRKTGALSLRSPAATNVSTPLESRSKGPHNKENYQNKRHSLDMASDDEVIFSGSGLTEDSGYLSLHNSQVDVDGLDSLERSEENCVSSQSLDVECHSGPCLPVLNFQEEACRELQRSYKKNRSYDWTVVDKVAENFGLHNVIGGKMGRQFVDILCKLMRKDMRHILARILGLLGDCDLISCTKVSRTWRKIICQDQLALQRWKKAEKTRRDSGRSMGSLSRDFTLDRVVFSCMQTVSSPPAHKAVKKPPCHMGGAQNATKSSRFQQYVEAAQSLKQHESLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSTPCRNTVRSFSSTQKTLVAGSARSKRSIRRL |
Proteomic databases
Interaction
Subunit
Part of a SCF (SKP1-cullin-F-box) protein ligase complex.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 25-67 | Disordered | ||||
Sequence: EVKGHKVSPRKTGALSLRSPAATNVSTPLESRSKGPHNKENYQ | ||||||
Compositional bias | 41-56 | Polar residues | ||||
Sequence: LRSPAATNVSTPLESR | ||||||
Domain | 187-234 | F-box | ||||
Sequence: CKLMRKDMRHILARILGLLGDCDLISCTKVSRTWRKIICQDQLALQRW | ||||||
Zinc finger | 311-359 | ZBR-type | ||||
Sequence: SLRRCSRCSSPARFDAVMQRAVCTRISCAFEFCTLCQSAFHDSTPCRNT |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length384
- Mass (Da)43,044
- Last updated2006-10-31 v2
- Checksum8ACEA017ECFF0E40
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 29 | in Ref. 2; AAI21729 | ||||
Sequence: H → R | ||||||
Sequence conflict | 40 | in Ref. 1; AAT68109 | ||||
Sequence: S → P | ||||||
Compositional bias | 41-56 | Polar residues | ||||
Sequence: LRSPAATNVSTPLESR | ||||||
Sequence conflict | 206 | in Ref. 1; AAT68109 | ||||
Sequence: G → A | ||||||
Sequence conflict | 250 | in Ref. 2; AAI15115 | ||||
Sequence: S → P | ||||||
Sequence conflict | 354 | in Ref. 1; AAT68109 | ||||
Sequence: T → N | ||||||
Sequence conflict | 360 | in Ref. 1; AAT68109 | ||||
Sequence: V → I |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY648791 EMBL· GenBank· DDBJ | AAT68109.1 EMBL· GenBank· DDBJ | mRNA | ||
BC115114 EMBL· GenBank· DDBJ | AAI15115.1 EMBL· GenBank· DDBJ | mRNA | ||
BC121728 EMBL· GenBank· DDBJ | AAI21729.1 EMBL· GenBank· DDBJ | mRNA | ||
BC129281 EMBL· GenBank· DDBJ | AAI29282.1 EMBL· GenBank· DDBJ | mRNA |