Q0QC81 · Q0QC81_KLEPN
- ProteinCytosine-specific methyltransferase
- Genedcm_2
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids477 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
Catalytic activity
- a 2'-deoxycytidine in DNA + S-adenosyl-L-methionine = a 5-methyl-2'-deoxycytidine in DNA + H+ + S-adenosyl-L-homocysteine
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 186 | |||||
Sequence: C |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | DNA (cytosine-5-)-methyltransferase activity | |
Molecular Function | DNA binding | |
Biological Process | DNA restriction-modification system | |
Biological Process | methylation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCytosine-specific methyltransferase
- EC number
Gene names
Encoded on
- Plasmid 12
- Plasmid 9
- Plasmid CNR48
- Plasmid U25P002
- Plasmid pBK30661
- Plasmid pBK30683
- Plasmid pBK31551
- Plasmid pGDK05
- Plasmid pIMP-1495
- Plasmid pK18An
- Plasmid pK245
- Plasmid pKP96
- Plasmid pKPI-6
- Plasmid pLK78
- Plasmid pNL194
- Plasmid pRYC11
- Plasmid pTR2
- Plasmid pUSKPC3
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Enterobacteriaceae > Klebsiella/Raoultella group > Klebsiella
Accessions
- Primary accessionQ0QC81
- Secondary accessions
Proteomes
Structure
Family & Domains
Features
Showing features for coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 1-28 | |||||
Sequence: MSEFELLAQDLLEKAEAEEQLRQENDKK | ||||||
Domain | 28-84 | DNA methylase N-terminal | ||||
Sequence: KLLGQVLEIYDQKYVAELLRKVGKNEWSRETLNRWINGKCSPKTLTLAEEELLRKML |
Sequence similarities
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length477
- Mass (Da)54,556
- Last updated2006-09-05 v1
- Checksum9E595D3809BCCAEA
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ449578 EMBL· GenBank· DDBJ | ABG56846.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EU195449 EMBL· GenBank· DDBJ | ABY74380.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
EU908090 EMBL· GenBank· DDBJ | ACH42172.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ223605 EMBL· GenBank· DDBJ | ACI63075.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FJ223607 EMBL· GenBank· DDBJ | ACI63184.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
GU585907 EMBL· GenBank· DDBJ | ADG84867.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
JX193301 EMBL· GenBank· DDBJ | AFZ77116.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF954759 EMBL· GenBank· DDBJ | AHL67956.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KF954760 EMBL· GenBank· DDBJ | AHL68052.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KJ721789 EMBL· GenBank· DDBJ | AIT41862.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KJ440075 EMBL· GenBank· DDBJ | AIU96916.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KM977631 EMBL· GenBank· DDBJ | AIW55674.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KJ187752 EMBL· GenBank· DDBJ | AJD77099.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT818627 EMBL· GenBank· DDBJ | ALL43186.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
KT818627 EMBL· GenBank· DDBJ | ALL43256.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AB616660 EMBL· GenBank· DDBJ | BAM29000.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
HF545435 EMBL· GenBank· DDBJ | CCN80109.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LK391770 EMBL· GenBank· DDBJ | CDR98211.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BNFF01000003 EMBL· GenBank· DDBJ | GHK58167.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FLGH01000033 EMBL· GenBank· DDBJ | SAW16965.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
LT994835 EMBL· GenBank· DDBJ | SPN80452.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UGKT01000004 EMBL· GenBank· DDBJ | STV76306.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UJTF01000036 EMBL· GenBank· DDBJ | SWV87820.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UKAW01000026 EMBL· GenBank· DDBJ | SXG19117.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
ULCI01000043 EMBL· GenBank· DDBJ | SYR48450.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CAAHAW010000035 EMBL· GenBank· DDBJ | VGJ61734.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CAAHCC010000027 EMBL· GenBank· DDBJ | VGL19229.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
UKIO02000035 EMBL· GenBank· DDBJ | VVL79953.1 EMBL· GenBank· DDBJ | Genomic DNA |