Q0JJV1 · VDAC4_ORYSJ
- ProteinMitochondrial outer membrane protein porin 4
- GeneVDAC4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids317 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective (By similarity).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial outer membrane | |
Cellular Component | pore complex | |
Molecular Function | porin activity | |
Molecular Function | voltage-gated monoatomic anion channel activity |
Keywords
- Molecular function
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMitochondrial outer membrane protein porin 4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0JJV1
- Secondary accessions
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000414087 | 1-317 | Mitochondrial outer membrane protein porin 4 | |||
Sequence: MEAETECKVPGVYSETGIPVEDPAPGLNSDVSKKDAPPAVAAPGPGLYFEIGKKARDLLYKDFHTDQKFTLTTYTNNGVVITAASTMKDEAIFSEIQTKLKSNNVMLDVKATSDSQVLTTITTEDLGVSGLKQIVSLPFPYQTAGKAELQYLHDYAGISLGVGLTSKPLVNLSGVFGNKSVAVGADVAVDTSTGDFTKYDAGLTINNSDLAADLTLNNKGDSLTASYYHLVNKESGTAAGAELTHSFSTKENTLSFGMQHALDPLTTVKARYNNHGMVSALIQHEWRPKSFLTLSAEVDTKAIDKASKVGLSLVLKP |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MEAETECKVPGVYSETGIPVEDPAPGLNSD |
Domain
Consists mainly of membrane-spanning sided beta-sheets.
Sequence similarities
Belongs to the eukaryotic mitochondrial porin (TC 1.B.8.1) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length317
- Mass (Da)33,757
- Last updated2011-12-14 v3
- Checksum464C45792452ABFB
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0N7KDM4 | A0A0N7KDM4_ORYSJ | Os01g0715500 | 209 |
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP003288 EMBL· GenBank· DDBJ | BAD87377.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP003408 EMBL· GenBank· DDBJ | BAD87575.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP008207 EMBL· GenBank· DDBJ | BAF05977.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP014957 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |