Q0JFF1 · Q0JFF1_ORYSJ
- ProteinOSJNBa0027H06.9 protein
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids731 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Molecular Function | ATP binding | |
Molecular Function | carbohydrate binding | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | defense response to other organism | |
Biological Process | protein phosphorylation |
Keywords
- Molecular function
- Ligand
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0JFF1
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MVCPNMLLRLLFLVCCSSSLA | ||||||
Chain | PRO_5038288117 | 22-731 | ||||
Sequence: ASAAAASSSSGSACSCSSSSDETSYSFPSTRIEDTLALLDDAEISSNNGSTILHLTPAASSNKSGTALLPTPVTLWRRLDYQTTAAQPGSYSKQDASLNTSFTMRVQYANAKYSPADDAAAAAAGLNNGLAFVIVPTINGPPPPGSAAAFAVEFETGDNRSITVSITTGGNIIAAATATTTTTNQTNSYYAVWIDYNGEKHRLLIYIDLQDRPKPQKPCLDVPLNLSSVVPDRAFIGFSATTTTTTTGGSSSAMDELLLHRYSILSWSLTVKLPPSPHGLDFEWKVILPAVVGTVAITAIMNVIVAAQYLNSKYNKLKMELVLTEALRRLPGTPREFKHAAIRKATNNFDEGRKLGNGGFGAVYRGTIRSSSSSAGKNKATTAAAAAVSSSSVEVAVKRFTRDENRCYDDFLAEVDIINRLRHRNVVPLVGWSYEKGELLLIYEYMPNGSLDRQLFPKEKPGRILGWTTRYGIVTDIAAGLHYVHHEHEHMVLHRDIKASNILLDAAFRGRLADFGLARIVVGLDKNSYTDVGVAETWGFIAPEYSVSHKATRKTDVYAFGVLLLEIVTGRRALCKFQGTFQLLVDWVWRLHREGSLLDAVDNGIASSTEEFDADDAIRLLLLGLACSNPNPSDRPSMTEVVQVVARSAAPPDVPPVKPAFVWPPEGGVEVDSDDVDSSGSDVYASLCEWEEEETSSSDALAVRVSSGYH |
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 370-682 | Protein kinase | ||||
Sequence: FDEGRKLGNGGFGAVYRGTIRSSSSSAGKNKATTAAAAAVSSSSVEVAVKRFTRDENRCYDDFLAEVDIINRLRHRNVVPLVGWSYEKGELLLIYEYMPNGSLDRQLFPKEKPGRILGWTTRYGIVTDIAAGLHYVHHEHEHMVLHRDIKASNILLDAAFRGRLADFGLARIVVGLDKNSYTDVGVAETWGFIAPEYSVSHKATRKTDVYAFGVLLLEIVTGRRALCKFQGTFQLLVDWVWRLHREGSLLDAVDNGIASSTEEFDADDAIRLLLLGLACSNPNPSDRPSMTEVVQVVARSAAPPDVPPVKPAF |
Sequence similarities
In the C-terminal section; belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
In the N-terminal section; belongs to the leguminous lectin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length731
- Mass (Da)78,871
- Last updated2020-02-26 v1
- ChecksumA1A3A1CAEB1DD133
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP008210 EMBL· GenBank· DDBJ | BAF13936.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL606642 EMBL· GenBank· DDBJ | CAD39426.2 EMBL· GenBank· DDBJ | Genomic DNA |