Q0JDK9 · DAD1_ORYSJ
- ProteinDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
- GeneDAD1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids114 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
Pathway
Protein modification; protein glycosylation.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | oligosaccharyltransferase complex | |
Biological Process | apoptotic process | |
Biological Process | protein N-linked glycosylation |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
- Short namesOligosaccharyl transferase subunit DAD1
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0JDK9
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-30 | Cytoplasmic | ||||
Sequence: MPRATSDAKLLIQSLGKAYAATPTNLKIID | ||||||
Transmembrane | 31-51 | Helical | ||||
Sequence: LYVVFAVATALIQVVYMGIVG | ||||||
Topological domain | 52-54 | Lumenal | ||||
Sequence: SFP | ||||||
Transmembrane | 55-75 | Helical | ||||
Sequence: FNSFLSGVLSCIGTAVLAVCL | ||||||
Topological domain | 76-93 | Cytoplasmic | ||||
Sequence: RIQVNKDNKEFKDLPPER | ||||||
Transmembrane | 94-114 | Helical | ||||
Sequence: AFADFVLCNLVLHLVIMNFLG |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000124028 | 1-114 | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 | |||
Sequence: MPRATSDAKLLIQSLGKAYAATPTNLKIIDLYVVFAVATALIQVVYMGIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQVNKDNKEFKDLPPERAFADFVLCNLVLHLVIMNFLG |
Proteomic databases
Structure
Sequence
- Sequence statusComplete
- Length114
- Mass (Da)12,379
- Last updated2006-10-03 v1
- Checksum0BE69A7E935FA301
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D89726 EMBL· GenBank· DDBJ | BAA24072.1 EMBL· GenBank· DDBJ | mRNA | ||
D89727 EMBL· GenBank· DDBJ | BAA24104.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL731591 EMBL· GenBank· DDBJ | CAE05147.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008210 EMBL· GenBank· DDBJ | BAF14578.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS89011.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000141 EMBL· GenBank· DDBJ | EAZ30582.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK063198 EMBL· GenBank· DDBJ | BAG88588.1 EMBL· GenBank· DDBJ | mRNA |