Q0JDC5 · INV2_ORYSJ
- ProteinBeta-fructofuranosidase, insoluble isoenzyme 2
- GeneCIN2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids598 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cell wall-associated invertase that cleaves sucrose into glucose and fructose and is required for assimilated carbon partitioning during early grain-filling. May be involved in sucrose unloaded in the ovular and stylar vascular tissues for the stimulation of starch synthesis in the developing endosperm during grain-filling (PubMed:18820698).
Sugar homeostasis mediated by CIN2/GIF1 plays an important role in constitutive and induced physical and chemical defense against pathogens (PubMed:24118770).
Sugar homeostasis mediated by CIN2/GIF1 plays an important role in constitutive and induced physical and chemical defense against pathogens (PubMed:24118770).
Catalytic activity
Biotechnology
CIN2/GIF1 is a potential domestication-selected gene that controls grain filling and yield, and could be used for further crop improvement.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 69 | |||||
Sequence: D |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Molecular Function | beta-fructofuranosidase activity | |
Biological Process | carbohydrate metabolic process | |
Biological Process | carbohydrate storage | |
Biological Process | defense response to bacterium | |
Biological Process | defense response to fungus |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameBeta-fructofuranosidase, insoluble isoenzyme 2
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0JDC5
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with the cell wall.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Slow grain-filling resulting in reduced weight of grains containing loosely packed starch granules and reduced levels of amylose and amylopectin.
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MGVLGSRVAWAWLVQLLLLQQLAGA | ||||||
Chain | PRO_0000033380 | 26-598 | Beta-fructofuranosidase, insoluble isoenzyme 2 | |||
Sequence: SHVVYDDLELQAAATTADGVPPSIVDSELRTGYHFQPPKNWINDPNAPMYYKGWYHLFYQYNPKGAVWGNIVWAHSVSRDLINWVALKPAIEPSIRADKYGCWSGSATMMADGTPVIMYTGVNRPDVNYQVQNVALPRNGSDPLLREWVKPGHNPVIVPEGGINATQFRDPTTAWRGADGHWRLLVGSLAGQSRGVAYVYRSRDFRRWTRAAQPLHSAPTGMWECPDFYPVTADGRREGVDTSSAVVDAAASARVKYVLKNSLDLRRYDYYTVGTYDRKAERYVPDDPAGDEHHIRYDYGNFYASKTFYDPAKRRRILWGWANESDTAADDVAKGWAGIQAIPRKVWLDPSGKQLLQWPIEEVERLRGKWPVILKDRVVKPGEHVEVTGLQTAQADVEVSFEVGSLEAAERLDPAMAYDAQRLCSARGADARGGVGPFGLWVLASAGLEEKTAVFFRVFRPAARGGGAGKPVVLMCTDPTKSSRNPNMYQPTFAGFVDTDITNGKISLRSLIDRSVVESFGAGGKACILSRVYPSLAIGKNARLYVFNNGKAEIKVSQLTAWEMKKPVMMNGA | ||||||
Glycosylation | 164 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 189 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 348 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in leaves and flowers. Weakly expressed in seeds (PubMed:15759120).
Expressed in growing roots, node and the rapidly elongating zone of the internode (PubMed:18820698).
Expressed in growing roots, node and the rapidly elongating zone of the internode (PubMed:18820698).
Induction
By sucrose in caryopsis from 1 to 2 and from 9 to 10 days after flowering.
Developmental stage
Expressed throughout flowering, with higher expression from 1 to 6 days after flowering (PubMed:15759120).
During early grain-filling, expressed in the ovular vascular and lateral stylar vascular traces (PubMed:18820698).
During early grain-filling, expressed in the ovular vascular and lateral stylar vascular traces (PubMed:18820698).
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length598
- Mass (Da)66,263
- Last updated2006-10-03 v1
- ChecksumDFAE59481FA19A4F
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY578159 EMBL· GenBank· DDBJ | AAT84402.1 EMBL· GenBank· DDBJ | mRNA | ||
AL662945 EMBL· GenBank· DDBJ | CAD40589.2 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP008210 EMBL· GenBank· DDBJ | BAF14662.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS89136.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000141 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |