Q0JDA2 · SDH5_ORYSJ
- ProteinSuccinate dehydrogenase subunit 5, mitochondrial
- GeneSDH5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids231 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score2/5
Function
Pathway
Carbohydrate metabolism; tricarboxylic acid cycle.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | respiratory chain complex II | |
Biological Process | tricarboxylic acid cycle |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSuccinate dehydrogenase subunit 5, mitochondrial
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0JDA2
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Peripheral membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-63 | Mitochondrion | ||||
Sequence: MAAALRSSCAAARRLLRISPAALSTLTAASSRPAAVAPLARPIAAAAVSGGNNAFSWNLRRLF | ||||||
Chain | PRO_0000431751 | 64-231 | Succinate dehydrogenase subunit 5, mitochondrial | |||
Sequence: SSNEKHLPAISDPEVESAFKDLMAASWTGLPDSLVIEAKKAASKATDDKAGKEALLNVFRAAEACEEFGGVLVTLRMALDDLCGITGENVGPLPGYIEDAVKSAYKRYMKYLESFGPEENYLRKKVENELGTKMIHLKMRCSGVGSEWGKITLIGTSGISGSYVELRA |
Proteomic databases
Interaction
Subunit
Component of complex II composed of eight subunits in plants: four classical SDH subunits SDH1, SDH2, SDH3 and SDH4 (a flavoprotein (FP), an iron-sulfur protein (IP), and a cytochrome b composed of a large and a small subunit.), as well as four subunits unknown in mitochondria from bacteria and heterotrophic eukaryotes.
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length231
- Mass (Da)24,583
- Last updated2006-10-03 v1
- ChecksumF44F13170BADFF53
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL606598 EMBL· GenBank· DDBJ | CAE03169.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AL606618 EMBL· GenBank· DDBJ | CAE02910.3 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP008210 EMBL· GenBank· DDBJ | BAF14685.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014960 EMBL· GenBank· DDBJ | BAS89168.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000141 EMBL· GenBank· DDBJ | EAZ30714.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AK099124 EMBL· GenBank· DDBJ | BAG93939.1 EMBL· GenBank· DDBJ | mRNA | ||
AK106155 EMBL· GenBank· DDBJ | BAG97606.1 EMBL· GenBank· DDBJ | mRNA | ||
AK119714 EMBL· GenBank· DDBJ | BAG99762.1 EMBL· GenBank· DDBJ | mRNA |