Q0IH24 · SPEF1_XENLA
- ProteinSperm flagellar protein 1
- Genespef1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids229 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Microtubule-associated protein involved in the stabilization of microtubules along the axis of migration during radial intercalation. Promotes the establishment and stabilization of an axis of microtubules required for the active migration of cells into the outer epithelium (PubMed:25070955).
Microtubule-associated protein that promotes microtubule bundling and stabilizes microtubules against depolymerization in response to cold shock (By similarity).
Essential for ciliary central apparatus formation which requires both its microtubule-binding and bundling activities (By similarity).
Regulates planar cell polarity signaling pathway and asymmetric microtubule accumulation in ciliated epithelia (PubMed:29514918).
Microtubule-associated protein that promotes microtubule bundling and stabilizes microtubules against depolymerization in response to cold shock (By similarity).
Essential for ciliary central apparatus formation which requires both its microtubule-binding and bundling activities (By similarity).
Regulates planar cell polarity signaling pathway and asymmetric microtubule accumulation in ciliated epithelia (PubMed:29514918).
Miscellaneous
Radial intercalation is a developmentally reiterated form of migration by which cells move in a direction orthogonal to the plane of the tissue from an inner layer to an outer layer.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 9+2 motile cilium | |
Cellular Component | apical plasma membrane | |
Cellular Component | axonemal central apparatus | |
Cellular Component | axoneme | |
Cellular Component | basolateral plasma membrane | |
Cellular Component | ciliary tip | |
Cellular Component | filopodium | |
Cellular Component | lamellipodium | |
Cellular Component | microtubule | |
Cellular Component | microvillus | |
Molecular Function | microtubule binding | |
Biological Process | axonemal central apparatus assembly | |
Biological Process | cell migration | |
Biological Process | cilium movement | |
Biological Process | filopodium assembly | |
Biological Process | lamellipodium assembly | |
Biological Process | microtubule bundle formation | |
Biological Process | negative regulation of microtubule depolymerization | |
Biological Process | regulation of Wnt signaling pathway, planar cell polarity pathway |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameSperm flagellar protein 1
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ0IH24
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Also found at the apical tip of cilia.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Morpholino knockdown of the protein at the four cell stage results in loss of planar cell polarity protein asymmetry, defects in cilia polarity and affects microtubule asymmetry.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000409220 | 1-229 | Sperm flagellar protein 1 | |||
Sequence: MAVEFDEETMQELYTWVDTIPLSRPKRNIARDFSDGVLTAELVKFYFPKLVEMHNYVPANSTTQKLSNWTILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEEKQRLHHISADLSQDQATQNNGNTHSDKGYKSNGTELSPRQGARVDPASKTHQGYAQAANADTTLRFQLAEKEQTLILSQETIQILQAKLRRLEQLLLLKNVRIDDLTRRLQELEKK |
Expression
Gene expression databases
Interaction
Subunit
Homodimer.
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-115 | Calponin-homology (CH) | ||||
Sequence: EETMQELYTWVDTIPLSRPKRNIARDFSDGVLTAELVKFYFPKLVEMHNYVPANSTTQKLSNWTILNRKVLSKLSFSVPDDVIRKIVQCSPGVVELVLNTLRQKIEEKQ | ||||||
Compositional bias | 122-151 | Polar residues | ||||
Sequence: ADLSQDQATQNNGNTHSDKGYKSNGTELSP | ||||||
Region | 122-169 | Disordered | ||||
Sequence: ADLSQDQATQNNGNTHSDKGYKSNGTELSPRQGARVDPASKTHQGYAQ | ||||||
Region | 178-229 | Essential for homodimerization and microtubule bundling activity | ||||
Sequence: RFQLAEKEQTLILSQETIQILQAKLRRLEQLLLLKNVRIDDLTRRLQELEKK |
Domain
The Calponin-homology domain mediates its binding to microtubules.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length229
- Mass (Da)26,241
- Last updated2006-10-03 v1
- Checksum9417F86FA5B68756
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 122-151 | Polar residues | ||||
Sequence: ADLSQDQATQNNGNTHSDKGYKSNGTELSP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC123353 EMBL· GenBank· DDBJ | AAI23354.1 EMBL· GenBank· DDBJ | mRNA |