Q0H8Y1 · AI5_USTMA
- ProteinProbable intron-encoded endonuclease aI5
- GeneaI5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids536 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Mitochondrial DNA endonuclease involved in intron homing.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial respiratory chain complex IV | |
Molecular Function | cytochrome-c oxidase activity | |
Molecular Function | endonuclease activity | |
Molecular Function | heme binding | |
Biological Process | electron transport coupled proton transport | |
Biological Process | intron homing | |
Biological Process | mitochondrial electron transport, cytochrome c to oxygen |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProbable intron-encoded endonuclease aI5
- Cleaved into 2 chains
Gene names
Encoded on
- Mitochondrion
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Basidiomycota > Ustilaginomycotina > Ustilaginomycetes > Ustilaginales > Ustilaginaceae > Ustilago
Accessions
- Primary accessionQ0H8Y1
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 15-35 | Helical | ||||
Sequence: TLYLIFAVFAAMIGTAFSVLI | ||||||
Transmembrane | 56-76 | Helical | ||||
Sequence: VIITAHAFVMIFFMVMPAMVG | ||||||
Transmembrane | 99-119 | Helical | ||||
Sequence: NISFWLLPPSLILLLASAFVE | ||||||
Transmembrane | 145-165 | Helical | ||||
Sequence: LAIFSLHLSGISSMLGAMNFI | ||||||
Transmembrane | 183-203 | Helical | ||||
Sequence: LFVWAIFVTAILLLLSLPVLA | ||||||
Transmembrane | 234-254 | Helical | ||||
Sequence: LFSKTTLYISFFYLIYKFTLL |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000271159 | ?-536 | Intron-encoded endonuclease aI5 | |||
Sequence: MVRWLYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSGISSMLGAMNFITTVLNMRNPGMTLHKLPLFVWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSFYDPAGGGDPILYQHLFSKTTLYISFFYLIYKFTLLKYSIYTNTGTTTVENVFNFNNFYLEYNKTYPNTKVPSTSFLEWFVGFTEGDGSFIVSTRGNLMFVITQSTMDIQVLHYIEQELGFGRVIKQGHKTSRFIVQDMNNLYILIQLFNGNIVFPSKQNSFFKFVHHFNKLSNFPTVAIISSLTVPTYYDNWFCGFTDARHPRGCFTCSLLGNSTAYRFRFLLTQKGEMNKEVLISIANLMKGTVRSHSVKDVYEITVNGIRNMEKIIDYFTNHKLYSKKAKSYQIWLEIYESIKNGEHLSPDSRNYLKMKTQQINK | ||||||
Chain | PRO_0000271158 | 1-? | Truncated non-functional cytochrome oxidase 1 |
Post-translational modification
The mature protein may arise from proteolytic cleavage of an in-frame translation of COX1 exons 1 to 5 plus intron 5, containing the aI5 open reading frame.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-235 | COX1 exons 1 to 5 encoded | ||||
Sequence: MVRWLYSTNAKDIGTLYLIFAVFAAMIGTAFSVLIRMELAAPGVQYLNGDHQLYNVIITAHAFVMIFFMVMPAMVGGFGNYLVPVMIGAPDMAFPRLNNISFWLLPPSLILLLASAFVEQGAGTGWTVYPPLSGLQSHSGGSVDLAIFSLHLSGISSMLGAMNFITTVLNMRNPGMTLHKLPLFVWAIFVTAILLLLSLPVLAGAITMLLTDRNFNTSFYDPAGGGDPILYQHLF | ||||||
Region | 237-536 | COX1 intron 5 encoded | ||||
Sequence: KTTLYISFFYLIYKFTLLKYSIYTNTGTTTVENVFNFNNFYLEYNKTYPNTKVPSTSFLEWFVGFTEGDGSFIVSTRGNLMFVITQSTMDIQVLHYIEQELGFGRVIKQGHKTSRFIVQDMNNLYILIQLFNGNIVFPSKQNSFFKFVHHFNKLSNFPTVAIISSLTVPTYYDNWFCGFTDARHPRGCFTCSLLGNSTAYRFRFLLTQKGEMNKEVLISIANLMKGTVRSHSVKDVYEITVNGIRNMEKIIDYFTNHKLYSKKAKSYQIWLEIYESIKNGEHLSPDSRNYLKMKTQQINK |
Sequence similarities
In the C-terminal section; belongs to the LAGLIDADG endonuclease family.
In the N-terminal section; belongs to the heme-copper respiratory oxidase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length536
- Mass (Da)60,704
- Last updated2007-01-09 v2
- ChecksumA6948B6FB2E17324
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DQ157700 EMBL· GenBank· DDBJ | AAZ67025.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AACP01000277 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |