Q0E8P0 · Q0E8P0_DROME
- Protein(6-4)-photolyase, isoform A
- Genephr6-4
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids540 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Cofactor
Note: Binds 1 FAD per subunit.
Features
Showing features for binding site, site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 246 | FAD (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 258 | FAD (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 258-262 | FAD (UniProtKB | ChEBI) | ||||
Sequence: TTVLS | ||||||
Binding site | 259 | FAD (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 260 | FAD (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 261 | FAD (UniProtKB | ChEBI) | ||||
Sequence: L | ||||||
Binding site | 262 | FAD (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 299-306 | FAD (UniProtKB | ChEBI) | ||||
Sequence: QLMWREFY | ||||||
Site | 330 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Binding site | 362 | FAD (UniProtKB | ChEBI) | ||||
Sequence: W | ||||||
Site | 384 | Electron transfer via tryptophanyl radical | ||||
Sequence: W | ||||||
Binding site | 397 | FAD (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 397-399 | FAD (UniProtKB | ChEBI) | ||||
Sequence: DQD | ||||||
Binding site | 399 | FAD (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 406 | FAD (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Site | 407 | Electron transfer via tryptophanyl radical | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | deoxyribodipyrimidine photo-lyase activity | |
Molecular Function | DNA binding | |
Molecular Function | FAD binding | |
Biological Process | circadian regulation of gene expression | |
Biological Process | entrainment of circadian clock by photoperiod |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ0E8P0
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 6-141 | Photolyase/cryptochrome alpha/beta | ||||
Sequence: STLVHWFRKGLRLHDNPALSHIFTAANAAPGKYFVRPIFILDPGILDWMQVGANRWRFLQQTLEDLDNQLRKLNSRLFVVRGKPAEVFPRIFKSWRVEMLTFETDIEPYSVTRDAAVQKLAKAEGVRVETHCSHTI | ||||||
Compositional bias | 504-526 | Basic and acidic residues | ||||
Sequence: VRTGKEEESSFEEKSETSTSGKR | ||||||
Region | 504-540 | Disordered | ||||
Sequence: VRTGKEEESSFEEKSETSTSGKRKVRRATGSAPKRKR |
Sequence similarities
Belongs to the DNA photolyase class-1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length540
- Mass (Da)62,493
- Last updated2006-10-17 v1
- ChecksumE6847E1B33C70ECB
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 504-526 | Basic and acidic residues | ||||
Sequence: VRTGKEEESSFEEKSETSTSGKR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AE014134 EMBL· GenBank· DDBJ | AAF53904.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AAN11080.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT044074 EMBL· GenBank· DDBJ | ACH92139.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014134 EMBL· GenBank· DDBJ | AGB93167.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014134 EMBL· GenBank· DDBJ | AGB93168.1 EMBL· GenBank· DDBJ | Genomic DNA |