Q0DFT7 · WRK19_ORYSJ
- ProteinTranscription factor WRKY19
- GeneWRKY19
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids277 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
May play a role in defense responses.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 100-168 | WRKY | ||||
Sequence: QDTASLDDGLSWRKYGQKDILGAKYPRAYFRCTHRHTQGCNATKQVQRADGDPLLFDVVYLGDHTCGQA |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | defense response |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTranscription factor WRKY19
- Short namesOsWRKY19
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ0DFT7
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000452039 | 1-277 | Transcription factor WRKY19 | |||
Sequence: MVELCGGEGEGQIMLATELAQLRAMARELEAKMDPDRVAARELCRALASSVDRSIRLAASCFPPPEHPPPAAGNAGRDAAFKKRKGMAKVRRQVRVTSVQDTASLDDGLSWRKYGQKDILGAKYPRAYFRCTHRHTQGCNATKQVQRADGDPLLFDVVYLGDHTCGQAAVAAAAQSAPPEHAGQEQQRQSSLLAAGTEGIHQQVVAEPMAAPFLFTSTAAGGVDDGYFSFISPANSDCQFSSDFSAGSVGVDMDHEARFEDLFSSTLEFFQSEIQNL |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length277
- Mass (Da)29,872
- Last updated2006-10-17 v1
- Checksum28853F77CF0F1440
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 85 | in Ref. 3; AAU44093 | ||||
Sequence: K → Q |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BK005022 EMBL· GenBank· DDBJ | DAA05084.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
HQ858860 EMBL· GenBank· DDBJ | ADX60272.1 EMBL· GenBank· DDBJ | mRNA | ||
AC104284 EMBL· GenBank· DDBJ | AAU44093.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008211 EMBL· GenBank· DDBJ | BAF18286.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014961 EMBL· GenBank· DDBJ | BAS95427.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000142 EMBL· GenBank· DDBJ | EEE64756.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK108389 EMBL· GenBank· DDBJ | BAG98392.1 EMBL· GenBank· DDBJ | mRNA |