Q0CS94 · TAZE_ASPTN
- ProteinTrans-enoyl reductase tazE
- GenetazE
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids303 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Trans-enoyl reductase; part of the gene cluster that mediates the biosynthesis of azaterrilone A and other azaphilones, a class of fungal metabolites characterized by a highly oxygenated pyrano-quinone bicyclic core and exhibiting a broad range of bioactivities (PubMed:35398258).
The first step of the pathway begins with the non-reducing polyketide synthase tazA that assembles one acetyl-CoA starter unit, five malonyl-CoA units, and catalyzes a series of Claisen condensations, methylation, PT-mediated cyclization, and finally releases the first hexaketide precursor through the R-domain. The tazA product then undergoes reduction on its terminal ketone and the following pyran-ring formation by yet undetermined enzyme(s). Dehydration and enoyl reduction, possibly involving the trans-enoyl reductase tazE leads to the next intermediate. TazD is predicted as an acetyltransferase and might catalyze the acetylation steps leading to the synthesis of azaterrilone A. Azaterrilone A is not the final product of the taz pathway and both the highly reducing polyketide synthase tazB and the dual enzyme tazHJ catalyze late steps of the pathway, leading to the production of the 2 final stereoisomers that contain additional polyketide modification whose structures have still to be determined (Probable)
The first step of the pathway begins with the non-reducing polyketide synthase tazA that assembles one acetyl-CoA starter unit, five malonyl-CoA units, and catalyzes a series of Claisen condensations, methylation, PT-mediated cyclization, and finally releases the first hexaketide precursor through the R-domain. The tazA product then undergoes reduction on its terminal ketone and the following pyran-ring formation by yet undetermined enzyme(s). Dehydration and enoyl reduction, possibly involving the trans-enoyl reductase tazE leads to the next intermediate. TazD is predicted as an acetyltransferase and might catalyze the acetylation steps leading to the synthesis of azaterrilone A. Azaterrilone A is not the final product of the taz pathway and both the highly reducing polyketide synthase tazB and the dual enzyme tazHJ catalyze late steps of the pathway, leading to the production of the 2 final stereoisomers that contain additional polyketide modification whose structures have still to be determined (Probable)
Pathway
Secondary metabolite biosynthesis.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 44-49 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: CDYYQR | ||||||
Binding site | 136-143 | substrate | ||||
Sequence: LAVLTALT | ||||||
Binding site | 170-173 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: SSSV | ||||||
Binding site | 193-196 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: SPKH | ||||||
Binding site | 211 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 246-247 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: LD | ||||||
Binding site | 265-269 | substrate | ||||
Sequence: VLPEC |
GO annotations
Aspect | Term | |
---|---|---|
Molecular Function | nucleotide binding | |
Molecular Function | oxidoreductase activity, acting on NAD(P)H |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTrans-enoyl reductase tazE
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Pezizomycotina > Eurotiomycetes > Eurotiomycetidae > Eurotiales > Aspergillaceae > Aspergillus > Aspergillus subgen. Circumdati
Accessions
- Primary accessionQ0CS94
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000456072 | 1-303 | Trans-enoyl reductase tazE | |||
Sequence: MTAEHDAAILPKPGGPLAVGKRATPEPGPNDVLIEVKAVALNPCDYYQRDYGMPPVPIYPAVIGGDAAGVVAKLGSSVTGGPVPGPGSRVIAFASSFYQNGSPDHGAFQKYALAQSEAVIPLPDNLSFEEGAVFPLAVLTALTAWTTIGIPLDTRYTPADKQAVLIWGASSSVGSFAVQSAKTLGFTVYATASPKHHELVKKLGADAVFDYKDSDVVSKIVDAVKKDGVYLHTAHCVVDGALQPTLDILKETKGDAFAKVAHSPVLPECHPTLDNTQITFNFPSMDEVVRTRISKLRRAVSRE |
Expression
Induction
Expression is positively regulated by the azaterrilone A cluster-specific transcription factor tazR.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-26 | Disordered | ||||
Sequence: MTAEHDAAILPKPGGPLAVGKRATPE |
Sequence similarities
Belongs to the zinc-containing alcohol dehydrogenase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length303
- Mass (Da)32,019
- Last updated2006-10-17 v1
- ChecksumF0568DB8884E3CA3
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CH476597 EMBL· GenBank· DDBJ | EAU36714.1 EMBL· GenBank· DDBJ | Genomic DNA |