Q09961 · HLH14_CAEEL
- ProteinHelix-loop-helix protein 14
- Genehlh-14
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids148 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable transcription factor, involved in determining neuroblast cell fate, morphogenesis and aspects of terminal differentiation in both left/right symmetric and asymmetric neuronal lineages.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHelix-loop-helix protein 14
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ09961
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown disrupts differentiation of ASE L/R sensory neurons.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 27 | In gm34; absent HSN motoneurons, PHB sensory neurons and PVQ neurons. | ||||
Sequence: L → F | ||||||
Mutagenesis | 54-148 | In ju243; absent PHB sensory neurons. | ||||
Sequence: Missing |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000452179 | 1-148 | Helix-loop-helix protein 14 | |||
Sequence: MAKKNQVARNERERKRVHQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQLQVLLNQDPQQPSVSSSTPDYTMNNSNNFNNYAVKEEFSMYLPQNYCPQNQMSVPHGDVSHNFNSPTSSVSSSSYSPTQMCYPPVSYSNYPHH |
Proteomic databases
Expression
Developmental stage
Expressed in both symmetric and asymmetric neuronal lineages (PubMed:21698137).
In the posterior embryo, expressed in PVQ/HSN/PHB neuroblasts and their descendants (PubMed:14627726, PubMed:21698137).
Expressed in the sensory ASE neuron lineage (PubMed:21698137).
In the posterior embryo, expressed in PVQ/HSN/PHB neuroblasts and their descendants (PubMed:14627726, PubMed:21698137).
Expressed in the sensory ASE neuron lineage (PubMed:21698137).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Disordered | ||||
Sequence: MAKKNQVARNERERKRVHQVN | ||||||
Region | 4-17 | Basic motif | ||||
Sequence: KNQVARNERERKRV | ||||||
Domain | 4-56 | bHLH | ||||
Sequence: KNQVARNERERKRVHQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQL | ||||||
Region | 18-56 | Helix-loop-helix motif | ||||
Sequence: HQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQL | ||||||
Region | 63-83 | Disordered | ||||
Sequence: DPQQPSVSSSTPDYTMNNSNN | ||||||
Region | 112-132 | Disordered | ||||
Sequence: GDVSHNFNSPTSSVSSSSYSP |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length148
- Mass (Da)17,148
- Last updated2015-11-11 v3
- ChecksumEEC47265E9177EE7
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284602 EMBL· GenBank· DDBJ | CCD65023.2 EMBL· GenBank· DDBJ | Genomic DNA |