Q09666 · AHNK_HUMAN
- ProteinNeuroblast differentiation-associated protein AHNAK
- GeneAHNAK
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids5890 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be required for neuronal cell differentiation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin cytoskeleton | |
Cellular Component | cell-cell contact zone | |
Cellular Component | costamere | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | focal adhesion | |
Cellular Component | lysosomal membrane | |
Cellular Component | membrane | |
Cellular Component | nucleus | |
Cellular Component | plasma membrane | |
Cellular Component | plasma membrane protein complex | |
Cellular Component | sarcolemma | |
Cellular Component | T-tubule | |
Cellular Component | vesicle | |
Molecular Function | cadherin binding | |
Molecular Function | identical protein binding | |
Molecular Function | RNA binding | |
Molecular Function | S100 protein binding | |
Molecular Function | structural molecule activity conferring elasticity | |
Biological Process | positive regulation of plasma membrane repair | |
Biological Process | regulation of RNA splicing | |
Biological Process | regulation of voltage-gated calcium channel activity |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNeuroblast differentiation-associated protein AHNAK
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ09666
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_039058 | 962 | in dbSNP:rs664761 | |||
Sequence: G → V | ||||||
Natural variant | VAR_039059 | 2114 | in dbSNP:rs1298288 | |||
Sequence: A → T | ||||||
Natural variant | VAR_061551 | 2247 | in dbSNP:rs61524789 | |||
Sequence: K → T | ||||||
Natural variant | VAR_039060 | 2439 | in dbSNP:rs11824660 | |||
Sequence: P → L | ||||||
Natural variant | VAR_039061 | 3003 | in dbSNP:rs566144 | |||
Sequence: Q → K | ||||||
Natural variant | VAR_039062 | 3190 | in dbSNP:rs11231129 | |||
Sequence: V → I | ||||||
Natural variant | VAR_039063 | 3724 | in dbSNP:rs11231128 | |||
Sequence: S → P | ||||||
Natural variant | VAR_061552 | 4304 | in dbSNP:rs11828907 | |||
Sequence: D → G | ||||||
Natural variant | VAR_039064 | 4561 | in dbSNP:rs12795508 | |||
Sequence: G → D | ||||||
Natural variant | VAR_039065 | 4611 | in dbSNP:rs12801302 | |||
Sequence: M → V | ||||||
Natural variant | VAR_039066 | 4613 | in dbSNP:rs12801153 | |||
Sequence: I → V | ||||||
Natural variant | VAR_039067 | 4631 | in dbSNP:rs12801123 | |||
Sequence: D → G | ||||||
Natural variant | VAR_039068 | 5415 | in dbSNP:rs11231126 | |||
Sequence: T → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 7,341 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data), cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000064504 | 1-5890 | UniProt | Neuroblast differentiation-associated protein AHNAK | |||
Sequence: MEKEETTRELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKGDRSPEPGQTWTREVFSSCSSEVVLSGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSRTITVTRRVTAYTVDVTGREGAKDIDISSPEFKIKIPRHELTEISNVDVETQSGKTVIRLPSGSGAASPTGSAVDIRAGAISASGPELQGAGHSKLQVTMPGIKVGGSGVNVNAKGLDLGGRGGVQVPAVDISSSLGGRAVEVQGPSLESGDHGKIKFPTMKVPKFGVSTGREGQTPKAGLRVSAPEVSVGHKGGKPGLTIQAPQLEVSVPSANIEGLEGKLKGPQITGPSLEGDLGLKGAKPQGHIGVDASAPQIGGSITGPSVEVQAPDIDVQGPGSKLNVPKMKVPKFSVSGAKGEETGIDVTLPTGEVTVPGVSGDVSLPEIATGGLEGKMKGTKVKTPEMIIQKPKISMQDVDLSLGSPKLKGDIKVSAPGVQGDVKGPQVALKGSRVDIETPNLEGTLTGPRLGSPSGKTGTCRISMSEVDLNVAAPKVKGGVDVTLPRVEGKVKVPEVDVRGPKVDVSAPDVEAHGPEWNLKMPKMKMPTFSTPGAKGEGPDVHMTLPKGDISISGPKVNVEAPDVNLEGLGGKLKGPDVKLPDMSVKTPKISMPDVDLHVKGTKVKGEYDVTVPKLEGELKGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSVPGFKAEGPEVDVNLPKADVDISGPKIDVTAPDVSIEEPEGKLKGPKFKMPEMNIKVPKISMPDVDLHLKGPNVKGEYDVTMPKVESEIKVPDVELKSAKMDIDVPDVEVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVGVEVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDVDLHMKGPKVKGEYDMTVPKLEGDLKGPKVDVSAPDVEMQGPDWNLKMPKIKMPKFSMPSLKGEGPEFDVNLSKANVDISAPKVDTNAPDLSLEGPEGKLKGPKFKMPEMHFRAPKMSLPDVDLDLKGPKMKGNVDISAPKIEGEMQVPDVDIRGPKVDIKAPDVEGQGLDWSLKIPKMKMPKFSMPSLKGEGPEVDVNLPKADVVVSGPKVDIEAPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDVDVSVPKVEGEMKVPDVEIKGPKMDIDAPDVEVQGPDWHLKMPKMKMPKFSMPGFKGEGREVDVNLPKADIDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLNLKGPKLKGDVDVSLPEVEGEMKVPDVDIKGPKVDISAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVKLPKADVDVSGPKMDAEVPDVNIEGPDAKLKGPKFKMPEMSIKPQKISIPDVGLHLKGPKMKGDYDVTVPKVEGEIKAPDVDIKGPKVDINAPDVEVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDMNLPKADLGVSGPKVDIDVPDVNLEAPEGKLKGPKFKMPSMNIQTHKISMPDVGLNLKAPKLKTDVDVSLPKVEGDLKGPEIDVKAPKMDVNVGDIDIEGPEGKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKVDIDAPDVEVHDPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADIDVSGPSVDTDAPDLDIEGPEGKLKGSKFKMPKLNIKAPKVSMPDVDLNLKGPKLKGEIDASVPELEGDLRGPQVDVKGPFVEAEVPDVDLECPDAKLKGPKFKMPEMHFKAPKISMPDVDLHLKGPKVKGDADVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMPDMHFKAPKISMPDVDLHLKGPKVKGDVDVSVPKLEGDLTGPSVGVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVDLHLKGPKVKGDMDVSVPKVEGEMKVPDVDIKGPKMDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVVVSGPKVDVEVPDVSLEGPEGKLKGPKLKMPEMHFKAPKISMPDVDLHLKGPKVKGDVDVSLPKLEGDLTGPSVDVEVPDVELECPDAKLKGPKFKMPEMHFKTPKISMPDVNLNLKGPKVKGDMDVSVPKVEGEMKVPDVDIRGPKVDIDAPDVDVHGPDWHLKMPKMKMPKFSMPGFKGEGPEVDVNLPKADVDVSGPKVDVEVPDVSLEGPEGKLKGPKFKMPEMHFKTPKISMPDVDFNLKGPKIKGDVDVSAPKLEGELKGPELDVKGPKLDADMPEVAVEGPNGKWKTPKFKMPDMHFKAPKISMPDLDLHLKSPKAKGEVDVDVPKLEGDLKGPHVDVSGPDIDIEGPEGKLKGPKFKMPDMHFKAPNISMPDVDLNLKGPKIKGDVDVSVPEVEGKLEVPDMNIRGPKVDVNAPDVQAPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDISGPKVDIEGPDVNIEGPEGKLKGPKLKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDINAPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDGDVKLPKADIDVSGPKVDIEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKIKMPKISMPGFKGEGPDVDVNLPKADIDVSGPKVDVECPDVNIEGPEGKWKSPKFKMPEMHFKTPKISMPDIDLNLTGPKIKGDVDVTGPKVEGDLKGPEVDLKGPKVDIDVPDVNVQGPDWHLKMPKMKMPKFSMPGFKAEGPEVDVNLPKADVDVSGPKVDVEGPDVNIEGPEGKLKGPKFKMPEMNIKAPKIPMPDFDLHLKGPKVKGDVDISLPKVEGDLKGPEVDIRGPQVDIDVPDVGVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMKVPDVDIKGPKVDINAPDVDVQGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDLDLNLKGPKMKGEVDVSLANVEGDLKGPALDIKGPKIDVDAPDIDIHGPDAKLKGPKLKMPDMHVNMPKISMPEIDLNLKGSKLKGDVDVSGPKLEGDIKAPSLDIKGPEVDVSGPKLNIEGKSKKSRFKLPKFNFSGSKVQTPEVDVKGKKPDIDITGPKVDINAPDVEVQGKVKGSKFKMPFLSISSPKVSMPDVELNLKSPKVKGDLDIAGPNLEGDFKGPKVDIKAPEVNLNAPDVDVHGPDWNLKMPKMKMPKFSVSGLKAEGPDVAVDLPKGDINIEGPSMNIEGPDLNVEGPEGGLKGPKFKMPDMNIKAPKISMPDIDLNLKGPKVKGDVDISLPKLEGDLKGPEVDIKGPKVDINAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVTLPKADIDISGPNVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLNLKGPKMKGDVVVSLPKVEGDLKGPEVDIKGPKVDIDTPDINIEGSEGKFKGPKFKIPEMHLKAPKISMPDIDLNLKGPKVKGDVDVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDIDLNLKGPKVKGDMDVSLPKVEGDMQVPDLDIKGPKVDINAPDVDVRGPDWHLKMPKIKMPKISMPGFKGEGPEVDVNLPKADLDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKMEGDLKAPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPEVDVNLPKADIDVSGPKVDIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKMKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADLDVSGPKVDIDVPDVNIEGPDAKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVEGDLKGPEVDIKGPKVDIDAPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVTLPKADIEISGPKVDIDAPDVSIEGPDAKLKGPKFKMPEMNIKAPKISMPDIDFNLKGPKVKGDVDVSLPKVEGDLKGPEIDIKGPSLDIDTPDVNIEGPEGKLKGPKFKMPEMNIKAPKISMPDFDLHLKGPKVKGDVDVSLPKVESDLKGPEVDIEGPEGKLKGPKFKMPDVHFKSPQISMSDIDLNLKGPKIKGDMDISVPKLEGDLKGPKVDVKGPKVGIDTPDIDIHGPEGKLKGPKFKMPDLHLKAPKISMPEVDLNLKGPKVKGDMDISLPKVEGDLKGPEVDIRDPKVDIDVPDVDVQGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVNLPKADIDVSGPKVDVDVPDVNIEGPDAKLKGPKFKMPEMSIKAPKISMPDIDLNLKGPKVKGDVDVTLPKVEGDLKGPEADIKGPKVDINTPDVDVHGPDWHLKMPKVKMPKFSMPGFKGEGPDVDVSLPKADIDVSGPKVDVDIPDVNIEGPDAKLKGPKFKMPEINIKAPKISIPDVDLDLKGPKVKGDFDVSVPKVEGTLKGPEVDLKGPRLDFEGPDAKLSGPSLKMPSLEISAPKVTAPDVDLHLKAPKIGFSGPKLEGGEVDLKGPKVEAPSLDVHMDSPDINIEGPDVKIPKFKKPKFGFGAKSPKADIKSPSLDVTVPEAELNLETPEISVGGKGKKSKFKMPKIHMSGPKIKAKKQGFDLNVPGGEIDASLKAPDVDVNIAGPDAALKVDVKSPKTKKTMFGKMYFPDVEFDIKSPKFKAEAPLPSPKLEGELQAPDLELSLPAIHVEGLDIKAKAPKVKMPDVDISVPKIEGDLKGPKVQANLGAPDINIEGLDAKVKTPSFGISAPQVSIPDVNVNLKGPKIKGDVPSVGLEGPDVDLQGPEAKIKFPKFSMPKIGIPGVKMEGGGAEVHAQLPSLEGDLRGPDVKLEGPDVSLKGPGVDLPSVNLSMPKVSGPDLDLNLKGPSLKGDLDASVPSMKVHAPGLNLSGVGGKMQVGGDGVKVPGIDATTKLNVGAPDVTLRGPSLQGDLAVSGDIKCPKVSVGAPDLSLEASEGSIKLPKMKLPQFGISTPGSDLHVNAKGPQVSGELKGPGVDVNLKGPRISAPNVDFNLEGPKVKGSLGATGEIKGPTVGGGLPGIGVQGLEGNLQMPGIKSSGCDVNLPGVNVKLPTGQISGPEIKGGLKGSEVGFHGAAPDISVKGPAFNMASPESDFGINLKGPKIKGGADVSGGVSAPDISLGEGHLSVKGSGGEWKGPQVSSALNLDTSKFAGGLHFSGPKVEGGVKGGQIGLQAPGLSVSGPQGHLESGSGKVTFPKMKIPKFTFSGRELVGREMGVDVHFPKAEASIQAGAGDGEWEESEVKLKKSKIKMPKFNFSKPKGKGGVTGSPEASISGSKGDLKSSKASLGSLEGEAEAEASSPKGKFSLFKSKKPRHRSNSFSDEREFSGPSTPTGTLEFEGGEVSLEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDETGKLQGSGVSLASKKSRLSSSSSNDSGNKVGIQLPEVELSVSTKKE | |||||||
Modified residue (large scale data) | 18 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 41 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 41 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 61 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 67 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 93 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 93 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 99 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 101 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 101 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 106 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 115 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 115 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 121 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Cross-link | 134 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | |||||||
Cross-link | 134 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | |||||||
Modified residue | 135 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 135 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 146 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 158 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 158 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 160 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 161 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 176 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 177 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 177 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 181 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 190 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 201 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 204 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 210 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 210 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 212 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 212 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 216 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 216 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 218 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 218 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 220 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 220 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 230 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 232 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 242 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 256 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 256 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 270 | UniProt | Omega-N-methylarginine | ||||
Sequence: R | |||||||
Modified residue (large scale data) | 283 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 298 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 324 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 332 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 332 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 337 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 337 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 379 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 379 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 407 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 440 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 470 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 470 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 490 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 490 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 501 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 508 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 511 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 511 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 539 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 545 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 551 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 551 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 553 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 553 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 559 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 559 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 561 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 570 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 570 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 572 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 572 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 590 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 613 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 637 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 638 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 651 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 658 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 658 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 660 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 691 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 694 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 698 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 712 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 715 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 718 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 763 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 781 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 793 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 793 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 819 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 819 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 836 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 845 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 856 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 891 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 909 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 942 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Cross-link | 961 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | |||||||
Cross-link | 961 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 964 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 1010 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1010 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1023 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1042 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1042 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1068 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1068 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1123 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1138 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1170 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1170 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1192 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 1196 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1196 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1208 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Modified residue | 1286 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1298 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1298 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1324 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1344 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1452 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1469 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 1472 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 1542 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1571 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1580 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1580 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1654 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1654 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1666 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Cross-link | 1726 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 1744 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1747 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1782 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1802 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1856 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1856 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1868 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 1885 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 1923 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1923 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 1935 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 1952 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 1986 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 1990 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 1990 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2002 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Cross-link | 2062 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 2092 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2092 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2118 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2118 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2130 | UniProt | N6-methyllysine | ||||
Sequence: K | |||||||
Cross-link | 2132 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 2138 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2138 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2147 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2150 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2181 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2185 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2287 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2287 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2309 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2313 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2387 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2397 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2397 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2423 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2454 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2524 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 2542 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2575 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 2580 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2580 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2594 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 2600 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2600 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2670 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2670 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2703 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 2708 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2722 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 2728 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 2728 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2798 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2832 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2832 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2836 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 2845 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2845 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 2908 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 2926 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 2959 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 2984 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3031 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3054 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3054 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3087 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 3092 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3112 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3182 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3215 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 3220 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3240 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3294 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3326 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3360 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3362 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3362 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3366 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 3409 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3409 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3411 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3412 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3412 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3426 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3426 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3483 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3509 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3544 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3564 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3625 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 3634 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3667 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 3672 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3716 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 3716 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 3724 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3746 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3760 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 3766 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3766 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3813 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3836 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3836 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3869 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 3874 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 3894 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 3964 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 3997 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4002 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4002 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4016 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4022 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4022 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4092 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4092 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4100 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4100 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4130 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4150 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4150 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4197 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4220 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4220 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4253 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4258 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4258 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4272 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4278 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4278 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4360 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4360 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4381 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 4386 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4400 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4406 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4406 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4425 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4425 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4430 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4430 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 4455 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4460 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4460 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 4474 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | |||||||
Modified residue | 4480 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4480 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4486 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4486 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4516 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4516 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4520 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4520 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4522 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4564 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4564 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4594 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4614 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4661 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4684 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4715 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4722 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4766 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4766 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 4803 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4812 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4812 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4850 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4870 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4877 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 4900 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4900 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4903 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4903 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4908 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4908 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4953 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4953 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4960 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4960 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4986 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4986 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 4993 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4993 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4995 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 4999 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 5009 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5009 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5013 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5031 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5077 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5077 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5089 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 5099 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5099 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5110 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5110 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5125 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5125 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5184 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5190 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5195 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5214 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5261 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5261 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5279 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5289 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5293 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5298 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5310 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5318 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5318 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5321 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5332 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5332 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5369 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5369 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5386 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5386 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5393 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5393 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5397 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5400 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5400 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5414 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5415 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5415 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5418 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5430 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5448 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5448 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5464 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5519 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5519 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5530 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5530 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5542 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5552 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5552 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5555 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5573 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5577 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5577 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5582 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5589 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5593 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5604 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5620 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5620 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 5623 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 5641 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5641 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5643 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5669 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5720 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5729 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 5731 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5731 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5735 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5737 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5739 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5739 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5745 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5746 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5749 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5749 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5752 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5752 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5762 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5762 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5763 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5763 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5780 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5780 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5782 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5782 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5784 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5790 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5790 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5793 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5793 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5794 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5794 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5796 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5798 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5807 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5824 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5824 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 5830 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5830 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5832 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5836 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 5839 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 5841 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5841 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5845 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 5845 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 5851 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5851 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5854 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5857 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5857 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5860 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 5863 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5863 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5864 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5865 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5866 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5867 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5870 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 5886 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with DYSF; the interaction is direct and Ca2+-independent.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q09666 | EGFR P00533 | 4 | EBI-2555881, EBI-297353 | |
BINARY | Q09666 | S100A10 P60903 | 2 | EBI-2555881, EBI-717048 | |
BINARY | Q09666-2 | NOL9 Q5SY16 | 3 | EBI-10245106, EBI-1055462 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 9-90 | PDZ | ||||
Sequence: ELLLPNWQGSGSHGLTIAQRDDGVFVQEVTQNSPAARTGVVKEGDQIVGATIYFDNLQSGEVTQLLNTMGHHTVGLKLHRKG | ||||||
Region | 314-347 | Disordered | ||||
Sequence: FGVSTGREGQTPKAGLRVSAPEVSVGHKGGKPGL | ||||||
Region | 545-564 | Disordered | ||||
Sequence: TPNLEGTLTGPRLGSPSGKT | ||||||
Region | 970-993 | Disordered | ||||
Sequence: KLEGDLKGPKVDVSAPDVEMQGPD | ||||||
Region | 1414-1438 | Disordered | ||||
Sequence: SGPKMDAEVPDVNIEGPDAKLKGPK | ||||||
Compositional bias | 1424-1438 | Basic and acidic residues | ||||
Sequence: DVNIEGPDAKLKGPK | ||||||
Region | 1741-1766 | Disordered | ||||
Sequence: IDVSGPSVDTDAPDLDIEGPEGKLKG | ||||||
Region | 2410-2439 | Disordered | ||||
Sequence: KLEGDLKGPHVDVSGPDIDIEGPEGKLKGP | ||||||
Region | 2542-2567 | Disordered | ||||
Sequence: SGPKVDIEGPDVNIEGPEGKLKGPKL | ||||||
Compositional bias | 2552-2567 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKL | ||||||
Region | 2610-2633 | Disordered | ||||
Sequence: GPEVDIKGPKVDINAPDVGVQGPD | ||||||
Region | 2667-2695 | Disordered | ||||
Sequence: IDVSGPKVDIEGPDVNIEGPEGKLKGPKF | ||||||
Compositional bias | 2680-2695 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKF | ||||||
Region | 2853-2882 | Disordered | ||||
Sequence: VDVTGPKVEGDLKGPEVDLKGPKVDIDVPD | ||||||
Compositional bias | 2854-2877 | Basic and acidic residues | ||||
Sequence: DVTGPKVEGDLKGPEVDLKGPKVD | ||||||
Region | 2921-2951 | Disordered | ||||
Sequence: ADVDVSGPKVDVEGPDVNIEGPEGKLKGPKF | ||||||
Compositional bias | 2936-2951 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKF | ||||||
Region | 3122-3145 | Disordered | ||||
Sequence: VPDVDIKGPKVDINAPDVDVQGPD | ||||||
Region | 3702-3730 | Disordered | ||||
Sequence: GPEVDIKGPKVDIDTPDINIEGSEGKFKG | ||||||
Compositional bias | 3763-3787 | Basic and acidic residues | ||||
Sequence: VDVSLPKMEGDLKGPEVDIKGPKVD | ||||||
Region | 3763-3799 | Disordered | ||||
Sequence: VDVSLPKMEGDLKGPEVDIKGPKVDINAPDVDVQGPD | ||||||
Region | 4093-4117 | Disordered | ||||
Sequence: GPKVDIDTPDIDIHGPEGKLKGPKF | ||||||
Region | 4147-4169 | Disordered | ||||
Sequence: VDVSLPKVEGDLKGPEVDIKGPK | ||||||
Region | 4416-4447 | Disordered | ||||
Sequence: GPEIDIKGPSLDIDTPDVNIEGPEGKLKGPKF | ||||||
Region | 4488-4508 | Disordered | ||||
Sequence: LKGPEVDIEGPEGKLKGPKFK | ||||||
Region | 4550-4581 | Disordered | ||||
Sequence: GPKVDVKGPKVGIDTPDIDIHGPEGKLKGPKF | ||||||
Region | 4611-4631 | Disordered | ||||
Sequence: MDISLPKVEGDLKGPEVDIRD | ||||||
Region | 4746-4768 | Disordered | ||||
Sequence: VEGDLKGPEADIKGPKVDINTPD | ||||||
Region | 4880-4904 | Disordered | ||||
Sequence: GPEVDLKGPRLDFEGPDAKLSGPSL | ||||||
Motif | 4971-4979 | Nuclear localization signal | ||||
Sequence: KIPKFKKPK | ||||||
Motif | 5019-5027 | Nuclear localization signal | ||||
Sequence: KKSKFKMPK | ||||||
Motif | 5034-5039 | Nuclear localization signal | ||||
Sequence: KIKAKK | ||||||
Motif | 5706-5716 | Nuclear localization signal | ||||
Sequence: KLKKSKIKMPK | ||||||
Region | 5716-5890 | Disordered | ||||
Sequence: KFNFSKPKGKGGVTGSPEASISGSKGDLKSSKASLGSLEGEAEAEASSPKGKFSLFKSKKPRHRSNSFSDEREFSGPSTPTGTLEFEGGEVSLEGGKVKGKHGKLKFGTFGGLGSKSKGHYEVTGSDDETGKLQGSGVSLASKKSRLSSSSSNDSGNKVGIQLPEVELSVSTKKE | ||||||
Compositional bias | 5732-5746 | Polar residues | ||||
Sequence: PEASISGSKGDLKSS | ||||||
Motif | 5772-5779 | Nuclear localization signal | ||||
Sequence: KSKKPRHR | ||||||
Compositional bias | 5844-5874 | Polar residues | ||||
Sequence: ETGKLQGSGVSLASKKSRLSSSSSNDSGNKV |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q09666-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length5,890
- Mass (Da)629,101
- Last updated2007-11-13 v2
- ChecksumA82FC9645FDCA8DC
Q09666-2
- Name2
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_044233 | 115-149 | in isoform 2 | |||
Sequence: SGDDEEYQRIYTTKIKPRLKSEDGVEGDLGETQSR → NTPQPSALECKDQNKQKEASSQAGAVSVSTPNAGL | ||||||
Alternative sequence | VSP_044234 | 150-5890 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 288 | in Ref. 4; AAA69899 | ||||
Sequence: A → P | ||||||
Sequence conflict | 302 | in Ref. 4; AAA69899 | ||||
Sequence: G → A | ||||||
Sequence conflict | 1156 | in Ref. 4; AAA69899 | ||||
Sequence: V → D | ||||||
Compositional bias | 1424-1438 | Basic and acidic residues | ||||
Sequence: DVNIEGPDAKLKGPK | ||||||
Sequence conflict | 1737 | in Ref. 4; AAA69899 | ||||
Sequence: P → R | ||||||
Sequence conflict | 1821 | in Ref. 4; AAA69899 | ||||
Sequence: F → L | ||||||
Compositional bias | 2552-2567 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKL | ||||||
Compositional bias | 2680-2695 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKF | ||||||
Compositional bias | 2854-2877 | Basic and acidic residues | ||||
Sequence: DVTGPKVEGDLKGPEVDLKGPKVD | ||||||
Compositional bias | 2936-2951 | Basic and acidic residues | ||||
Sequence: DVNIEGPEGKLKGPKF | ||||||
Compositional bias | 3763-3787 | Basic and acidic residues | ||||
Sequence: VDVSLPKMEGDLKGPEVDIKGPKVD | ||||||
Sequence conflict | 4614 | in Ref. 4; AAA69898 | ||||
Sequence: S → T | ||||||
Sequence conflict | 4627 | in Ref. 4; AAA69898 | ||||
Sequence: V → A | ||||||
Sequence conflict | 4630-4631 | in Ref. 4; AAA69898 | ||||
Sequence: RD → KG | ||||||
Sequence conflict | 4637-4638 | in Ref. 4; AAA69898 | ||||
Sequence: DV → NT | ||||||
Sequence conflict | 4644 | in Ref. 4; AAA69898 | ||||
Sequence: Q → H | ||||||
Sequence conflict | 4830 | in Ref. 4; AAA69898 | ||||
Sequence: A → P | ||||||
Sequence conflict | 4834 | in Ref. 4; AAA69898 | ||||
Sequence: G → V | ||||||
Sequence conflict | 4837 | in Ref. 4; AAA69898 | ||||
Sequence: F → V | ||||||
Sequence conflict | 4984 | in Ref. 4; AAA69898 | ||||
Sequence: A → P | ||||||
Sequence conflict | 5445 | in Ref. 4; AAA69898 | ||||
Sequence: P → S | ||||||
Compositional bias | 5732-5746 | Polar residues | ||||
Sequence: PEASISGSKGDLKSS | ||||||
Compositional bias | 5844-5874 | Polar residues | ||||
Sequence: ETGKLQGSGVSLASKKSRLSSSSSNDSGNKV |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP001363 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AP003064 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471076 EMBL· GenBank· DDBJ | EAW74019.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC128460 EMBL· GenBank· DDBJ | AAI28461.1 EMBL· GenBank· DDBJ | mRNA | ||
M80899 EMBL· GenBank· DDBJ | AAA69898.1 EMBL· GenBank· DDBJ | mRNA | ||
M80902 EMBL· GenBank· DDBJ | AAA69899.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |