Q09604 · VAB15_CAEEL
- ProteinHomeobox protein vab-15
- Genevab-15
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids225 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Probable transcription factor needed for the proper production of touch cell precursors (PubMed:11333230).
Involved in specification of lateral neuroblasts (PubMed:28716930).
Essential for embryonic morphogenesis (PubMed:11333230).
Involved in specification of lateral neuroblasts (PubMed:28716930).
Essential for embryonic morphogenesis (PubMed:11333230).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 129-188 | Homeobox | ||||
Sequence: NRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQ |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II transcription regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | embryonic morphogenesis | |
Biological Process | locomotory behavior | |
Biological Process | parturition | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein vab-15
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ09604
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Worms exhibit the absence of AVM, PVM, and PLM touch cells, defective egg laying, embryonic or larval lethality, cell degeneration, malformation of the posterior body, and uncoordinated movement.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000049350 | 1-225 | Homeobox protein vab-15 | |||
Sequence: MVSKDEKPKQSGLFSVESLLETPKQKCREDLPKPTPITPKTPMLIPGLHPMTPYFGAQLDPVMIYFAQTGNRLPIVSSDSSPESCASSPLSMQHSLQWLSSQREDSPTSDDAKIQIGLSKCMLRKHKNNRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQEAEVEKVKFAQASAYAAAAVGGAPDPSSILAFYQPQW |
Proteomic databases
Expression
Tissue specificity
Expressed in the ectodermal cells of embryos and seam cells and ventral cord motor neurons of young larvae.
Developmental stage
Expressed from the twofold embryo stage through to L4 larval stage (PubMed:11333230).
Expressed in the embryonic mother cell of Q and V5 neuroblasts, AB.p(lr)apapaa, and abolished in V5 neuroblasts after division but maintained in Q cells until they divide (PubMed:28716930).
Expressed in P-neuroblasts before hatching, maintained while P nuclei migrate into the ventral midline in early L1-stage larvae, and declines after P-neuroblasts divide (PubMed:28716930).
Expressed in the embryonic mother cell of Q and V5 neuroblasts, AB.p(lr)apapaa, and abolished in V5 neuroblasts after division but maintained in Q cells until they divide (PubMed:28716930).
Expressed in P-neuroblasts before hatching, maintained while P nuclei migrate into the ventral midline in early L1-stage larvae, and declines after P-neuroblasts divide (PubMed:28716930).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-44 | Disordered | ||||
Sequence: MVSKDEKPKQSGLFSVESLLETPKQKCREDLPKPTPITPKTPML |
Sequence similarities
Belongs to the Msh homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length225
- Mass (Da)25,228
- Last updated1995-11-01 v1
- ChecksumE7C920E9E1B9AC93
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF286218 EMBL· GenBank· DDBJ | AAF88063.1 EMBL· GenBank· DDBJ | mRNA | ||
Z48621 EMBL· GenBank· DDBJ | CAA88539.1 EMBL· GenBank· DDBJ | Genomic DNA |