Q08BM8 · CNOT7_DANRE
- ProteinCCR4-NOT transcription complex subunit 7
- Genecnot7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids286 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression (By similarity).
Catalytic activity
Cofactor
Mg2+ (UniProtKB | Rhea| CHEBI:18420 )
Co2+ (UniProtKB | Rhea| CHEBI:48828 )
Note: Binds 2 divalent metal cations per subunit with RNAase activity being higher in presence of Mn2+ than of Mg2+ or Co2+.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 40 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 40 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 42 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Binding site | 161 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 230 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 278 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: E |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | CCR4-NOT complex | |
Cellular Component | CCR4-NOT core complex | |
Cellular Component | nucleus | |
Cellular Component | P-body | |
Molecular Function | 3'-5'-RNA exonuclease activity | |
Molecular Function | metal ion binding | |
Molecular Function | poly(A)-specific ribonuclease activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA exonuclease activity | |
Biological Process | miRNA-mediated gene silencing by mRNA destabilization | |
Biological Process | mRNA catabolic process | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay | |
Biological Process | positive regulation of nuclear-transcribed mRNA poly(A) tail shortening | |
Biological Process | regulation of translation | |
Biological Process | regulatory ncRNA-mediated gene silencing |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCCR4-NOT transcription complex subunit 7
- EC number
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ08BM8
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000313895 | 1-286 | CCR4-NOT transcription complex subunit 7 | |||
Sequence: MPAATVDHSQRICEVWACNLEEEMKRIRQVTRKFNYIAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTSSGIQFKKHEEEGIETMYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILSNSKLPDEEVDFFEILRLFFPIIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQQS |
Proteomic databases
Expression
Gene expression databases
Interaction
Structure
Sequence
- Sequence statusComplete
- Length286
- Mass (Da)32,876
- Last updated2006-10-31 v1
- Checksum98916F3D24A7B539
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M9QB61 | A0A8M9QB61_DANRE | cnot7 | 189 | ||
A0A8M9QKP5 | A0A8M9QKP5_DANRE | cnot7 | 295 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC124650 EMBL· GenBank· DDBJ | AAI24651.1 EMBL· GenBank· DDBJ | mRNA |