Q08970 · MMT2_YEAST
- ProteinMitochondrial metal transporter 2
- GeneMMT2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids484 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Mitochondrial metal transporter involved in mitochondrial iron accumulation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | mitochondrial membrane | |
Cellular Component | mitochondrion | |
Molecular Function | monoatomic cation transmembrane transporter activity | |
Biological Process | intracellular iron ion homeostasis | |
Biological Process | iron ion transport |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameMitochondrial metal transporter 2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ08970
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 132-152 | Helical | ||||
Sequence: ITWIGLASNVGMAVGKFVGGI | ||||||
Transmembrane | 158-178 | Helical | ||||
Sequence: ALLADSVHALSDLVSDFLTLF | ||||||
Transmembrane | 209-229 | Helical | ||||
Sequence: ILAMAGISIGWSSLCAIVGPV | ||||||
Transmembrane | 256-276 | Helical | ||||
Sequence: ATNVNAVWIAAGSILVKEWVF | ||||||
Transmembrane | 316-336 | Helical | ||||
Sequence: YFFNIQSLDNLGGLVVSGLII |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-56 | Mitochondrion | ||||
Sequence: MLRISIDSIKQFGSFVPGYNNTSYHAAGRAIRTSSLYSTMISANPRRCLHSSKLLN | ||||||
Chain | PRO_0000255968 | 57-484 | Mitochondrial metal transporter 2 | |||
Sequence: KEGQEEGYNEQLISKMSSQNGSNSRQNESEGKKEGKASSVKSLLQHTHSHSHTHMHDNPLLSLNVQQIKKNPGVRITWIGLASNVGMAVGKFVGGITFHSQALLADSVHALSDLVSDFLTLFSVQYASRKPTSEYPYGYGKVETVGSLAVSTILAMAGISIGWSSLCAIVGPVIPHAILESMAGLIGETHSHSQSLTQQATNVNAVWIAAGSILVKEWVFQATKKVAIQTNSNVLMANAWHHRVDSLTSLVALVAITSSYFFNIQSLDNLGGLVVSGLIIKTGGQGILSSLKELVDQSIPPTDPRYLEIESVIKDSIGSLKTDLDLKQSLHVRDLTILASGPNLRATTTLEVPVLHSGQEVGIRFLENAISTIREDLRMKVPNVGKVDVEFVDVTSDSKGDLEHSHDTKSTNHTHTHSDSADTHTHKH |
Proteomic databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 73-114 | Disordered | ||||
Sequence: SSQNGSNSRQNESEGKKEGKASSVKSLLQHTHSHSHTHMHDN | ||||||
Region | 453-484 | Disordered | ||||
Sequence: DSKGDLEHSHDTKSTNHTHTHSDSADTHTHKH |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length484
- Mass (Da)52,434
- Last updated2011-09-21 v2
- ChecksumF9BD946F38D10B31
Sequence caution
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 17 | in Ref. 1; CAA97939 | ||||
Sequence: P → T |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z73580 EMBL· GenBank· DDBJ | CAA97939.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
BK006949 EMBL· GenBank· DDBJ | DAA11212.2 EMBL· GenBank· DDBJ | Genomic DNA |