Q08170 · SRSF4_HUMAN
- ProteinSerine/arginine-rich splicing factor 4
- GeneSRSF4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids494 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in alternative splice site selection during pre-mRNA splicing. Represses the splicing of MAPT/Tau exon 10.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nuclear speck | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | RNA binding | |
Molecular Function | sequence-specific mRNA binding | |
Biological Process | mRNA processing | |
Biological Process | mRNA splicing, via spliceosome | |
Biological Process | negative regulation of mRNA splicing, via spliceosome | |
Biological Process | response to insulin | |
Biological Process | RNA splicing | |
Biological Process | RNA splicing, via transesterification reactions |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSerine/arginine-rich splicing factor 4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ08170
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_052230 | 253 | in dbSNP:rs2230679 | |||
Sequence: E → D | ||||||
Natural variant | VAR_052231 | 338 | in dbSNP:rs2230677 | |||
Sequence: G → A | ||||||
Natural variant | VAR_052232 | 356 | in dbSNP:rs2230678 | |||
Sequence: G → S | ||||||
Natural variant | VAR_052233 | 438 | in dbSNP:rs1049928 | |||
Sequence: Q → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 450 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000081925 | 1-494 | UniProt | Serine/arginine-rich splicing factor 4 | |||
Sequence: MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSRRRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKSRSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRSREESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKSESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRSHSRS | |||||||
Modified residue | 78 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 78 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 84 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 112 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 113 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 116 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 151 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 179 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 267 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 269 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 288 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 290 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 292 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 304 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 316 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 420 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 422 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 423 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 431 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 431 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 442 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 444 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 446 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 446 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 448 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 450 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 456 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 456 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 458 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 458 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 460 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 460 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 462 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Extensively phosphorylated on serine residues in the RS domain.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Found in a pre-mRNA splicing complex with SRSF4/SFRS4, SRSF5/SFRS5, SNRNP70, SNRPA1, SRRM1 and SRRM2. Interacts with PNN.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q08170 | JPH3 Q8WXH2 | 3 | EBI-722621, EBI-1055254 | |
BINARY | Q08170 | SRSF6 Q13247 | 4 | EBI-722621, EBI-745230 | |
BINARY | Q08170 | TRA2B P62995 | 4 | EBI-722621, EBI-725485 | |
BINARY | Q08170 | UBE2I Q7KZS0 | 3 | EBI-722621, EBI-10180829 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-72 | RRM 1 | ||||
Sequence: PRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDLCGERVIVEHARG | ||||||
Region | 72-95 | Disordered | ||||
Sequence: GPRRDGSYGSGRSGYGYRRSGRDK | ||||||
Domain | 104-177 | RRM 2 | ||||
Sequence: YRLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKP | ||||||
Region | 169-494 | Disordered | ||||
Sequence: KIRLVEDKPGSRRRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRSKKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDNVGKPKSRSPSRHKSKSKSRSRSQERRVEEEKRGSVSRGRSQEKSLRQSRSRSRSKGGSRSRSRSRSKSKDKRKGRKRSREESRSRSRSRSKSERSRKRGSKRDSKAGSSKKKKKEDTDRSQSRSPSRSVSKEREHAKSESSQREGRGESENAGTNQETRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPSRSRSRSHSRS | ||||||
Compositional bias | 182-242 | Basic residues | ||||
Sequence: RRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRS | ||||||
Compositional bias | 243-282 | Basic and acidic residues | ||||
Sequence: KKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDN | ||||||
Compositional bias | 303-331 | Basic and acidic residues | ||||
Sequence: RSQERRVEEEKRGSVSRGRSQEKSLRQSR | ||||||
Compositional bias | 332-356 | Basic residues | ||||
Sequence: SRSRSKGGSRSRSRSRSKSKDKRKG | ||||||
Compositional bias | 391-428 | Basic and acidic residues | ||||
Sequence: SKKKKKEDTDRSQSRSPSRSVSKEREHAKSESSQREGR | ||||||
Compositional bias | 429-461 | Polar residues | ||||
Sequence: GESENAGTNQETRSRSRSNSKSKPNLPSESRSR | ||||||
Compositional bias | 465-494 | Basic residues | ||||
Sequence: ASKTRSRSKSRSRSASRSPSRSRSRSHSRS |
Sequence similarities
Belongs to the splicing factor SR family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length494
- Mass (Da)56,678
- Last updated2002-05-15 v2
- Checksum5BBAB917C218C20A
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0D9SEM4 | A0A0D9SEM4_HUMAN | SRSF4 | 378 | ||
S4R2X6 | S4R2X6_HUMAN | SRSF4 | 160 |
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 35 | in Ref. 6; AA sequence | ||||
Sequence: N → D | ||||||
Compositional bias | 182-242 | Basic residues | ||||
Sequence: RRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRSRS | ||||||
Compositional bias | 243-282 | Basic and acidic residues | ||||
Sequence: KKEKSRSPSKEKSRSRSHSAGKSRSKSKDQAEEKIQNNDN | ||||||
Compositional bias | 303-331 | Basic and acidic residues | ||||
Sequence: RSQERRVEEEKRGSVSRGRSQEKSLRQSR | ||||||
Sequence conflict | 318-322 | in Ref. 1; AAA36649 | ||||
Sequence: SRGRS → EQGQE | ||||||
Compositional bias | 332-356 | Basic residues | ||||
Sequence: SRSRSKGGSRSRSRSRSKSKDKRKG | ||||||
Compositional bias | 391-428 | Basic and acidic residues | ||||
Sequence: SKKKKKEDTDRSQSRSPSRSVSKEREHAKSESSQREGR | ||||||
Compositional bias | 429-461 | Polar residues | ||||
Sequence: GESENAGTNQETRSRSRSNSKSKPNLPSESRSR | ||||||
Sequence conflict | 436-438 | in Ref. 1; AAA36649 | ||||
Sequence: TNQ → RNE | ||||||
Compositional bias | 465-494 | Basic residues | ||||
Sequence: ASKTRSRSKSRSRSASRSPSRSRSRSHSRS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L14076 EMBL· GenBank· DDBJ | AAA36649.1 EMBL· GenBank· DDBJ | mRNA | ||
BT007415 EMBL· GenBank· DDBJ | AAP36083.1 EMBL· GenBank· DDBJ | mRNA | ||
AL590729 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL357500 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC002781 EMBL· GenBank· DDBJ | AAH02781.1 EMBL· GenBank· DDBJ | mRNA | ||
AC004236 EMBL· GenBank· DDBJ | AAC04476.1 EMBL· GenBank· DDBJ | Genomic DNA |