Q07E44 · WNT2_DASNO
- ProteinProtein Wnt-2
- GeneWNT2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids360 (go to sequence)
- Protein existenceInferred from homology
- Annotation score4/5
Function
function
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | collagen-containing extracellular matrix | |
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Molecular Function | frizzled binding | |
Biological Process | canonical Wnt signaling pathway | |
Biological Process | cell fate commitment | |
Biological Process | cell proliferation in midbrain | |
Biological Process | cell-cell signaling | |
Biological Process | cellular response to transforming growth factor beta stimulus | |
Biological Process | mammary gland epithelium development | |
Biological Process | midbrain dopaminergic neuron differentiation | |
Biological Process | positive regulation of fibroblast proliferation | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein Wnt-2
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Xenarthra > Cingulata > Dasypodidae > Dasypus
Accessions
- Primary accessionQ07E44
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, lipidation, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MNAPLGGIWLWLPLLLTWLTPEVSS | ||||||
Chain | PRO_0000260341 | 26-360 | Protein Wnt-2 | |||
Sequence: SWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPDVMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVVFAITRACSQGELKSCSCDPKKKGTAKDSKGTFDWGGCSDNIDHGIKFARAFVDAKERKGKDARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNGAIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSLGTAGRVCNLTSRGMDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWAVPT | ||||||
Disulfide bond | 76↔87 | |||||
Sequence: CQHQFRQHRWNC | ||||||
Disulfide bond | 127↔135 | |||||
Sequence: CSQGELKSC | ||||||
Disulfide bond | 137↔157 | |||||
Sequence: CDPKKKGTAKDSKGTFDWGGC | ||||||
Disulfide bond | 206↔220 | |||||
Sequence: CKCHGVSGSCTLRTC | ||||||
Disulfide bond | 208↔215 | |||||
Sequence: CHGVSGSC | ||||||
Lipidation | 212 | O-palmitoleoyl serine; by PORCN | ||||
Sequence: S | ||||||
Disulfide bond | 278↔309 | |||||
Sequence: CIRDRDAGSLGTAGRVCNLTSRGMDSCEVMCC | ||||||
Disulfide bond | 294↔304 | |||||
Sequence: CNLTSRGMDSC | ||||||
Glycosylation | 295 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 308↔348 | |||||
Sequence: CCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTC | ||||||
Disulfide bond | 324↔339 | |||||
Sequence: CECKFHWCCAVRCQDC | ||||||
Disulfide bond | 326↔336 | |||||
Sequence: CKFHWCCAVRC | ||||||
Disulfide bond | 331↔332 | |||||
Sequence: CC |
Post-translational modification
Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.
Keywords
- PTM
PTM databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length360
- Mass (Da)40,426
- Last updated2006-10-31 v1
- ChecksumD85C3C7FB9516E77
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
DP000181 EMBL· GenBank· DDBJ | ABI93632.1 EMBL· GenBank· DDBJ | Genomic DNA |