Q07876 · RSMH_BACSU
- ProteinRibosomal RNA small subunit methyltransferase H
- GenersmH
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids311 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA.
Catalytic activity
- cytidine1402 in 16S rRNA + S-adenosyl-L-methionine = H+ + N4-methylcytidine1402 in 16S rRNA + S-adenosyl-L-homocysteine
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 32-34 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: AGH | ||||||
Binding site | 52 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 79 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 100 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 107 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: Q |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | rRNA (cytosine-N4-)-methyltransferase activity | |
Biological Process | rRNA base methylation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibosomal RNA small subunit methyltransferase H
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageBacteria > Bacillota > Bacilli > Bacillales > Bacillaceae > Bacillus
Accessions
- Primary accessionQ07876
Proteomes
Subcellular Location
Phenotypes & Variants
Disruption phenotype
No visible phenotype.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000108578 | 1-311 | Ribosomal RNA small subunit methyltransferase H | |||
Sequence: MFQHKTVLLRETVDGLNIKPDGTYVDCTLGGAGHSTYLLQQLSEKGRLIAFDQDDTALQHAKEVLSDYKGQLILIKSNFRYLKEYLNEQGVTEVDGILFDLGVSSPQLDTPERGFSYHHDAPLDMRMDQSATLSAKEVVNEWRYEDLVRIFFKYGEEKFSKQIARKIEEARMKSPIQTTGQLVDLIKDAIPAPARRSGGHPAKRVFQAIRIAVNDELRVFEEALEQAIEVLKPGGRVSVITFHSLEDRICKTTFKEKSSLPELPPGLPVIPEEFEPELKLITRKPITASQEELEENNRARSAKLRIAEKRK |
Proteomic databases
Expression
Induction
Transcribed at a low level in exponential phase, it may be further induced in stationary phase. Part of the mraZ-rsmH-ftsL-pbpB operon.
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 287-311 | Disordered | ||||
Sequence: TASQEELEENNRARSAKLRIAEKRK | ||||||
Compositional bias | 288-311 | Basic and acidic residues | ||||
Sequence: ASQEELEENNRARSAKLRIAEKRK |
Sequence similarities
Belongs to the methyltransferase superfamily. RsmH family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length311
- Mass (Da)35,305
- Last updated1996-10-01 v2
- ChecksumC50C609129DFD4AD
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 288-311 | Basic and acidic residues | ||||
Sequence: ASQEELEENNRARSAKLRIAEKRK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z68230 EMBL· GenBank· DDBJ | CAA92525.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL009126 EMBL· GenBank· DDBJ | CAB13387.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L09703 EMBL· GenBank· DDBJ | AAC36835.1 EMBL· GenBank· DDBJ | Unassigned DNA |