Q07750 · ADF1_CAEEL
- ProteinActin-depolymerizing factor 1, isoforms a/b
- Geneunc-60
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids212 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Depolymerizes growing actin filaments in muscle cells; required for the assembly of actin filaments into the functional contractile myofilament lattice of muscle (PubMed:8107682).
Competes with unc-87 for actin binding and inhibits the actin-bundling activity of unc-87 (PubMed:17684058).
Competes with unc-87 for actin binding and inhibits the actin-bundling activity of unc-87 (PubMed:17684058).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | actin cytoskeleton | |
Cellular Component | cytoplasm | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | striated muscle thin filament | |
Molecular Function | actin filament binding | |
Biological Process | actin filament depolymerization | |
Biological Process | actin filament fragmentation | |
Biological Process | actin filament severing | |
Biological Process | embryo development ending in birth or egg hatching | |
Biological Process | locomotion | |
Biological Process | muscle thin filament assembly | |
Biological Process | positive regulation of actin filament polymerization | |
Biological Process | skeletal muscle thin filament assembly |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameActin-depolymerizing factor 1, isoforms a/b
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionQ07750
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000214938 | 1-212 | Actin-depolymerizing factor 1, isoforms a/b | |||
Sequence: MSSGVMVDPDVQTSFQKLSEGRKEYRYIIFKIDENKVIVEAAVTQDQLGITGDDYDDSSKAAFDKFVEDVKSRTDNLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKMVYASSAAAIKTSLGTGKILQFQVSDESEMSHKELLNNCPDNAPVRRRMLYASSVRALKASLGLESLFQVQASEMSDLDEKSVKSDLMSNQRI |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 3-159 | ADF-H | ||||
Sequence: SGVMVDPDVQTSFQKLSEGRKEYRYIIFKIDENKVIVEAAVTQDQLGITGDDYDDSSKAAFDKFVEDVKSRTDNLTDCRYAVFDFKFTCSRVGAGTSKMDKIIFLQICPDGASIKKKMVYASSAAAIKTSLGTGKILQFQVSDESEMSHKELLNNCP |
Sequence similarities
Belongs to the actin-binding proteins ADF family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing. Isoforms only share an exon that codes for the initiator Met.
Q07750-2
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Nameb
- Length212
- Mass (Da)23,578
- Last updated2006-09-05 v2
- Checksum30616B9CC8F9D716
Q07750-1
- Namea
- SynonymsADF1
Q07749-1
The sequence of this isoform can be found in the external entry linked below. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly.
View isoform- Namec
- SynonymsADF2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q07749 | ADF2_CAEEL | unc-60 | 152 |
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L18963 EMBL· GenBank· DDBJ | AAC14458.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO080816 EMBL· GenBank· DDBJ | CCD67021.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO080816 EMBL· GenBank· DDBJ | CCD67022.1 EMBL· GenBank· DDBJ | Genomic DNA |