Q06696 · VPS36_YEAST
- ProteinVacuolar protein-sorting-associated protein 36
- GeneVPS36
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids566 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the ESCRT-II complex, which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs (PubMed:12194858, PubMed:15329733, PubMed:15469844).
The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation (PubMed:12194858).
The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (PubMed:12194858).
Involved in the trafficking of the plasma membrane ATPase (PubMed:12194858).
Its ability to bind ubiquitin plays a central role in endosomal sorting of ubiquitinated cargo proteins by the ESCRT complexes (PubMed:15029239).
The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation (PubMed:12194858).
The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex (PubMed:12194858).
Involved in the trafficking of the plasma membrane ATPase (PubMed:12194858).
Its ability to bind ubiquitin plays a central role in endosomal sorting of ubiquitinated cargo proteins by the ESCRT complexes (PubMed:15029239).
Miscellaneous
Present with 2470 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ESCRT II complex | |
Cellular Component | late endosome membrane | |
Molecular Function | metal ion binding | |
Molecular Function | phosphatidylinositol-3-phosphate binding | |
Molecular Function | ubiquitin binding | |
Biological Process | ATP export | |
Biological Process | carbon catabolite repression of transcription from RNA polymerase II promoter by glucose | |
Biological Process | cytoplasm to vacuole targeting by the Cvt pathway | |
Biological Process | macroautophagy | |
Biological Process | protein retention in Golgi apparatus | |
Biological Process | protein targeting to vacuole | |
Biological Process | protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway | |
Biological Process | ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameVacuolar protein-sorting-associated protein 36
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ06696
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endosome membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 187-188 | Abolishes ubiquitin-binding and vacuole sorting of ubiquitinated proteins. | ||||
Sequence: TF → GS |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 9 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215227 | 1-566 | Vacuolar protein-sorting-associated protein 36 | |||
Sequence: MEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKDPSSKDELGKSAETASADVVSTWVCPICMVSNETQGEFTKDTLPTPICINCGVPADYELTKSSINCSNAIDPNANPQNQFGVNSENICPACTFANHPQIGNCEICGHRLPNASKVRSKLNRLNFHDSRVHIELEKNSLARNKSSHSALSSSSSTGSSTEFVQLSFRKSDGVLFSQATERALENILTEKNKHIFNQNVVSVNGVDMRKGASSHEYNNEVPFIETKLSRIGISSLEKSRENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITMKTKTLNLQDESTVNEPKTRRPLLILDREKFLNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREACERFEHLGLNELKLVKVNKRILCVTSEKFDVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDEGDLLIDKQLSGIYYYKNSYWPSHI |
Proteomic databases
PTM databases
Interaction
Subunit
Component of the endosomal sorting required for transport complex II (ESCRT-II), which consists of 2 copies of VPS25, 1 copy of SNF8, and 1 copy of VPS36 (PubMed:15329733, PubMed:15469844).
The ESCRT-II complex interacts directly with the VPS20 subunit of the ESCRT-III complex (PubMed:12194858).
Binds ubiquitin (PubMed:15029239).
The ESCRT-II complex interacts directly with the VPS20 subunit of the ESCRT-III complex (PubMed:12194858).
Binds ubiquitin (PubMed:15029239).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q06696 | SNF8 Q12483 | 11 | EBI-36540, EBI-30277 | |
XENO | Q06696 | Ubc P62991 | 2 | EBI-36540, EBI-413074 | |
BINARY | Q06696 | VPS25 P47142 | 4 | EBI-36540, EBI-25595 | |
BINARY | Q06696 | VPS28 Q02767 | 6 | EBI-36540, EBI-20387 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 7-96 | GLUE N-terminal | ||||
Sequence: VETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYSSGFLTRSPRLILFFKD | ||||||
Zinc finger | 114-151 | RanBP2-type 1; degenerate | ||||
Sequence: VVSTWVCPICMVSNETQGEFTKDTLPTPICINCGVPAD | ||||||
Zinc finger | 177-205 | RanBP2-type 2 | ||||
Sequence: VNSENICPACTFANHPQIGNCEICGHRLP | ||||||
Domain | 255-288 | GLUE C-terminal | ||||
Sequence: FVQLSFRKSDGVLFSQATERALENILTEKNKHIF |
Domain
The second RanBP2-type zinc-finger is functional and binds ubiquitin.
Sequence similarities
Belongs to the VPS36 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length566
- Mass (Da)64,018
- Last updated1996-11-01 v1
- Checksum60DDD4EA3A620409
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U20162 EMBL· GenBank· DDBJ | AAB67493.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006945 EMBL· GenBank· DDBJ | DAA09719.1 EMBL· GenBank· DDBJ | Genomic DNA |