Q06643 · TNFC_HUMAN
- ProteinLymphotoxin-beta
- GeneLTB
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids244 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytokine that binds to LTBR/TNFRSF3 (PubMed:24248355).
May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface. Isoform 2 is probably non-functional.
May play a specific role in immune response regulation. Provides the membrane anchor for the attachment of the heterotrimeric complex to the cell surface. Isoform 2 is probably non-functional.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | plasma membrane | |
Molecular Function | cytokine activity | |
Molecular Function | signaling receptor binding | |
Molecular Function | tumor necrosis factor receptor binding | |
Biological Process | cell-cell signaling | |
Biological Process | gene expression | |
Biological Process | immune response | |
Biological Process | lymph node development | |
Biological Process | positive regulation of canonical NF-kappaB signal transduction | |
Biological Process | positive regulation of extrinsic apoptotic signaling pathway | |
Biological Process | positive regulation of interleukin-12 production | |
Biological Process | signal transduction | |
Biological Process | skin development |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLymphotoxin-beta
- Short namesLT-beta
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ06643
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type II membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-18 | Cytoplasmic | ||||
Sequence: MGALGLEGRGGRLQGRGS | ||||||
Transmembrane | 19-48 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: LLLAVAGATSLVTLLLAVPITVLAVLALVP | ||||||
Topological domain | 49-244 | Extracellular | ||||
Sequence: QDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant, mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_013025 | 70 | in dbSNP:rs3093554 | |||
Sequence: G → E | ||||||
Natural variant | VAR_016331 | 84 | in dbSNP:rs4647186 | |||
Sequence: S → R | ||||||
Natural variant | VAR_016332 | 87 | in dbSNP:rs4647187 | |||
Sequence: L → F | ||||||
Mutagenesis | 108 | In subunit 1; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109 and E-142, and 'A-142' in LTA. In subunit 2; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109 and E-142, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with R-109; E-142 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA. | ||||
Sequence: K → E | ||||||
Mutagenesis | 109 | In subunit 1; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and E-142, and 'A-142' in LTA. In subunit 2; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and E-142, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108; E-142 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA. | ||||
Sequence: E → R | ||||||
Natural variant | VAR_013026 | 111 | in dbSNP:rs3093555 | |||
Sequence: A → P | ||||||
Natural variant | VAR_029145 | 122 | in dbSNP:rs2229699 | |||
Sequence: A → D | ||||||
Mutagenesis | 142 | In subunit 1; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and R-109, and 'A-142' in LTA. In subunit 2; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108 and R-109, and with 'A-170' in LTB (subunit 1). In subunit 1; abolishes binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108; R-109 and A-170, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA. | ||||
Sequence: R → E | ||||||
Mutagenesis | 170 | In subunit 2; no significant effect on binding of LTA1-LTB2 to LTBR and LTBR-mediated NF-kappa-B signaling activation. In subunit 1; reduces binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with 'E-108', 'R-109' and 'E-142' in LTB (subunit 2). In subunit 1, abolishes binding of LTA1-LTB2 to LTBR and abolishes LTBR-mediated NF-kappa-B signaling activation; when associated with E-108; R-109 and E-142, and with 'E-108'; 'R-109' and 'E-142' in LTB (subunit 2), and with 'A-142' in LTA. | ||||
Sequence: Y → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 598 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000185486 | 1-244 | Lymphotoxin-beta | |||
Sequence: MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETADPGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMVG | ||||||
Glycosylation | 222 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Spleen and thymus.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 88-243 | THD | ||||
Sequence: PAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFSDAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLEGAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGAVMV |
Sequence similarities
Belongs to the tumor necrosis factor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q06643-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length244
- Mass (Da)25,390
- Last updated1994-06-01 v1
- ChecksumF41569459830ED4C
Q06643-2
- Name2
Features
Showing features for alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L11016 EMBL· GenBank· DDBJ | AAA99888.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U89922 EMBL· GenBank· DDBJ | AAC51769.1 EMBL· GenBank· DDBJ | mRNA | ||
U79029 EMBL· GenBank· DDBJ | AAB37342.1 EMBL· GenBank· DDBJ | mRNA | ||
L11015 EMBL· GenBank· DDBJ | AAA36191.1 EMBL· GenBank· DDBJ | mRNA | ||
Y14768 EMBL· GenBank· DDBJ | CAA75069.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF129756 EMBL· GenBank· DDBJ | AAD18089.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BA000025 EMBL· GenBank· DDBJ | BAB63395.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY070219 EMBL· GenBank· DDBJ | AAL49954.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY070219 EMBL· GenBank· DDBJ | AAL49955.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY216497 EMBL· GenBank· DDBJ | AAO21134.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK312210 EMBL· GenBank· DDBJ | BAG35143.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471081 EMBL· GenBank· DDBJ | EAX03425.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC069330 EMBL· GenBank· DDBJ | AAH69330.1 EMBL· GenBank· DDBJ | mRNA | ||
BC093783 EMBL· GenBank· DDBJ | AAH93783.1 EMBL· GenBank· DDBJ | mRNA |