Q05728 · PUR5_ARATH
- ProteinPhosphoribosylformylglycinamidine cyclo-ligase, chloroplastic
- GenePUR5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids389 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
Catalytic activity
- 2-formamido-N1-(5-O-phospho-beta-D-ribosyl)acetamidine + ATP = 5-amino-1-(5-phospho-beta-D-ribosyl)imidazole + ADP + H+ + phosphate
Pathway
Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole from N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide: step 2/2.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Cellular Component | mitochondrion | |
Molecular Function | ATP binding | |
Molecular Function | copper ion binding | |
Molecular Function | phosphoribosylformylglycinamidine cyclo-ligase activity | |
Biological Process | 'de novo' IMP biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePhosphoribosylformylglycinamidine cyclo-ligase, chloroplastic
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ05728
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-58 | Chloroplast | ||||
Sequence: MEARILQSSSSCYSSLYAVNRSRFSSVSSPKPFSVSFAQTTRTRTRVLSMSKKDGRTD | ||||||
Chain | PRO_0000029881 | 59-389 | Phosphoribosylformylglycinamidine cyclo-ligase, chloroplastic | |||
Sequence: KDDDTDSLNYKDSGVDIDAGAELVKRIAKMAPGIGGFGGLFPLGDSYLVAGTDGVGTKLKLAFETGIHDTIGIDLVAMSVNDIITSGAKPLFFLDYFATSRLDVDLAEKVIKGIVEGCRQSECALLGGETAEMPDFYAEGEYDLSGFAVGIVKKTSVINGKNIVAGDVLIGLPSSGVHSNGFSLVRRVLARSNLSLKDALPGGSSTLGDALMAPTVIYVKQVLDMIEKGGVKGLAHITGGGFTDNIPRVFPDGLGAVIHTDAWELPPLFKWIQQTGRIEDSEMRRTFNLGIGMVMVVSPEAASRILEEVKNGDYVAYRVGEVVNGEGVSYQ |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 46-65 | Disordered | ||||
Sequence: RVLSMSKKDGRTDKDDDTDS | ||||||
Compositional bias | 47-65 | Basic and acidic residues | ||||
Sequence: VLSMSKKDGRTDKDDDTDS |
Sequence similarities
Belongs to the AIR synthase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length389
- Mass (Da)41,504
- Last updated2002-05-27 v2
- ChecksumF341E9D21E9286F0
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 47-65 | Basic and acidic residues | ||||
Sequence: VLSMSKKDGRTDKDDDTDS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
L12457 EMBL· GenBank· DDBJ | AAC37341.1 EMBL· GenBank· DDBJ | Unassigned DNA | Frameshift | |
AL049655 EMBL· GenBank· DDBJ | CAB41083.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL132970 EMBL· GenBank· DDBJ | CAB82696.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE79327.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE79328.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY060585 EMBL· GenBank· DDBJ | AAL31210.1 EMBL· GenBank· DDBJ | mRNA | ||
AY142054 EMBL· GenBank· DDBJ | AAM98318.1 EMBL· GenBank· DDBJ | mRNA |