Q04199 · CAC2_YEAST
- ProteinChromatin assembly factor 1 subunit p60
- GeneCAC2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids468 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a component of chromatin assembly factor 1 (CAF-1), which assembles histone octamers onto replicating DNA in vitro. It performs the first step of the nucleosome assembly process, bringing newly synthesized histones H3 and H4 to replicating DNA; histones H2A/H2B can bind to this chromatin precursor subsequent to DNA replication to complete the histone octamer. p50 and p60 form complexes with newly synthesized histones H3 and acetylated H4 in cell extracts (By similarity).
Miscellaneous
Present with 2130 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | CAF-1 complex | |
Cellular Component | chromosome, centromeric region | |
Cellular Component | cytosol | |
Cellular Component | nucleosome | |
Cellular Component | nucleus | |
Biological Process | chromatin organization | |
Biological Process | DNA repair | |
Biological Process | DNA replication | |
Biological Process | DNA replication-dependent chromatin assembly | |
Biological Process | nucleosome assembly |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameChromatin assembly factor 1 subunit p60
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ04199
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000050894 | 1-468 | Chromatin assembly factor 1 subunit p60 | |||
Sequence: MEASHLQIYWHDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQNGGVRKIESLDFLGSLTHHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQESVVRPFGMDAETSEADENKEKWVVWKRLRGGSGATAAAEIYDLAWSPDNRNIVVACMDNSIRLFDVGAGMLVCGQSDHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVVTGLKLRSKIAKAELPCPGDVLRTNYLFHNETLPSFFRRCSISPCGGLVVIPSGVYKVAGDEVANCVYVYTRSGILNSAGGVKNRPAIRIPSLKKPALMAAFSPVFYETCQKSVLKLPYKLVFAIATTNEVLVYDTDVLEPLCVVGNIHYSPITDLAWSEDGSTLLISSTDGFCSYVSIDTETQFGSRIEPPAMHAEPLDTDESAVAAKNQREAGGIVNMLPVKKIPCNSSDSKKRRIHPTPVDL |
Proteomic databases
PTM databases
Interaction
Subunit
Component of chromatin assembly factor 1 (CAF-1), which is composed of MSI1/p50, CAC2/p60 and CAC1/p90 (Probable). Interacts with RTT106 (PubMed:19683497).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q04199 | MSI1 P13712 | 4 | EBI-3920, EBI-11391 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 11-52 | WD 1 | ||||
Sequence: HDSQPVYSLTFQKNSANDKLFTAGGDNKVRIWKLNRDENGQN | ||||||
Repeat | 69-108 | WD 2 | ||||
Sequence: HHEQAINVIRFNSKGDVLASAGDDGQVLLWKQEDPNTQQE | ||||||
Repeat | 143-182 | WD 3 | ||||
Sequence: TAAAEIYDLAWSPDNRNIVVACMDNSIRLFDVGAGMLVCG | ||||||
Repeat | 185-224 | WD 4 | ||||
Sequence: DHGHYVQGVAWDPLNQFILSQSADRSLHVYGVILSSAGVV | ||||||
Repeat | 371-413 | WD 5 | ||||
Sequence: IHYSPITDLAWSEDGSTLLISSTDGFCSYVSIDTETQFGSRIE |
Sequence similarities
Belongs to the WD repeat HIR1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length468
- Mass (Da)51,252
- Last updated1997-11-01 v1
- ChecksumF24853C4AA4D97C2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X80835 EMBL· GenBank· DDBJ | CAA56795.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006946 EMBL· GenBank· DDBJ | DAA09796.1 EMBL· GenBank· DDBJ | Genomic DNA |