Q04087 · LRS4_YEAST
- ProteinMonopolin complex subunit LRS4
- GeneLRS4
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids347 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the monopolin complex which promotes monoorientation during meiosis I, required for chromosome segregation during meiosis. Involved in rDNA silencing.
Miscellaneous
Present with 1390 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | monopolin complex | |
Cellular Component | nucleolus | |
Cellular Component | nucleus | |
Biological Process | homologous chromosome segregation | |
Biological Process | meiotic chromosome segregation | |
Biological Process | protein localization to nucleolar rDNA repeats | |
Biological Process | rDNA chromatin condensation | |
Biological Process | rDNA heterochromatin formation | |
Biological Process | replication-born double-strand break repair via sister chromatid exchange | |
Biological Process | spindle attachment to meiosis I kinetochore |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMonopolin complex subunit LRS4
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ04087
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Transiently released from the nucleolus and localized to the centromere regions during late pachytene. This relocation is CDC5 dependent.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000257808 | 1-347 | Monopolin complex subunit LRS4 | |||
Sequence: MTTLLQLLSNYYKAKLDSERIYNEYVQSQYEFASLDKLNNNKGDPKKVVDETLFLQRQIAQLNKQLQLSFQENEKLLSVQKNQKALYQSKLSSKDAFIDDLKLKLKVEQISVDKHNKERTPSTGRDEQQRNSKAAHTSKPTIHLLSPIVNRDKPNNQTNDRGGNDPDSPTSQRRSRGLRSLLSSGKNTIFDSISKNLDDEINENAHIRNDTTSSKIAGKSPSRLSALQKSPELRKERNNMILKEHILRSKDDQNITSSRKLDNIELSSIGDSTAMTSRSSTVNANDILGNEENDGITKLKRVNKLTSSPVKRDCSTNKKRKLTKQRIATLPNSDEELSNNLNVDEFV | ||||||
Modified residue | 168 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 230 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated by CDC5. This phosphorylation is required for the location to the kinetochores during late pachytene.
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the monopolin complex composed of at least CSM1, LRS4 and MAM1. The complex associates with the kinetochore.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q04087 | CDC5 P32562 | 6 | EBI-32189, EBI-4440 | |
BINARY | Q04087 | CDC7 P06243 | 5 | EBI-32189, EBI-4451 | |
BINARY | Q04087 | CSM1 P25651 | 16 | EBI-32189, EBI-22001 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 46-118 | |||||
Sequence: KKVVDETLFLQRQIAQLNKQLQLSFQENEKLLSVQKNQKALYQSKLSSKDAFIDDLKLKLKVEQISVDKHNKE | ||||||
Compositional bias | 112-133 | Basic and acidic residues | ||||
Sequence: VDKHNKERTPSTGRDEQQRNSK | ||||||
Region | 112-183 | Disordered | ||||
Sequence: VDKHNKERTPSTGRDEQQRNSKAAHTSKPTIHLLSPIVNRDKPNNQTNDRGGNDPDSPTSQRRSRGLRSLLS | ||||||
Compositional bias | 150-183 | Polar residues | ||||
Sequence: NRDKPNNQTNDRGGNDPDSPTSQRRSRGLRSLLS | ||||||
Compositional bias | 208-227 | Polar residues | ||||
Sequence: RNDTTSSKIAGKSPSRLSAL | ||||||
Region | 208-230 | Disordered | ||||
Sequence: RNDTTSSKIAGKSPSRLSALQKS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length347
- Mass (Da)39,354
- Last updated1996-11-01 v1
- Checksum60D880BA947B9005
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 112-133 | Basic and acidic residues | ||||
Sequence: VDKHNKERTPSTGRDEQQRNSK | ||||||
Compositional bias | 150-183 | Polar residues | ||||
Sequence: NRDKPNNQTNDRGGNDPDSPTSQRRSRGLRSLLS | ||||||
Compositional bias | 208-227 | Polar residues | ||||
Sequence: RNDTTSSKIAGKSPSRLSAL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U33007 EMBL· GenBank· DDBJ | AAB64867.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA12276.1 EMBL· GenBank· DDBJ | Genomic DNA |