Q03935 · YAP6_YEAST
- ProteinAP-1-like transcription factor YAP6
- GeneYAP6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids383 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Transcription activator involved in the regulation of genes expressed in response to environmental changes and metabolic requirements. According to genome-wide promoter binding and gene expression studies it regulates, among others, genes involved in ribosome biogenesis, protein synthesis, carbohydrate metabolism, and carbohydrate transport. It may also be involved in pleiotropic drug resistance. When overexpressed, it confers resistance to cisplatin, methylmethanosulfonate, and mitomycin C, and increases cellular tolerance to sodium and lithium.
Miscellaneous
One of 8 closely related fungi-specific YAP proteins (YAP1 to YAP8), which all seem to be transcription activators of the environmental stress response and metabolism control pathways and to have similar but not identical DNA binding specificities.
Present with 1400 molecules/cell in log phase SD medium.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAP-1-like transcription factor YAP6
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ03935
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000076526 | 1-383 | AP-1-like transcription factor YAP6 | |||
Sequence: MQNPPLIRPDMYNQGSSSMATYNASEKNLNEHPSPQIAQPSTSQKLPYRINPTTTNGDTDISVNSNPIQPPLPNLMHLSGPSDYRSMHQSPIHPSYIIPPHSNERKQSASYNRPQNAHVSIQPSVVFPPKSYSISYAPYQINPPLPNGLPNQSISLNKEYIAEEQLSTLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQKAFRQRKEKYIKNLEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQHEAIRNAITMLRSEYDVLCNENNMLKNENSIIKNEHNMSRNENENLKLENKRFHAEYIRMIEDIENTKRKEQEQRDEIEQLKKKIRSLEEIVGRHSDSAT |
Proteomic databases
PTM databases
Expression
Induction
Seems to activate its own expression and that of the repressor ROX1 which in turn represses YAP6 expression.
Structure
Family & Domains
Features
Showing features for region, compositional bias, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-64 | Disordered | ||||
Sequence: MQNPPLIRPDMYNQGSSSMATYNASEKNLNEHPSPQIAQPSTSQKLPYRINPTTTNGDTDISVN | ||||||
Region | 83-113 | Disordered | ||||
Sequence: DYRSMHQSPIHPSYIIPPHSNERKQSASYNR | ||||||
Compositional bias | 168-235 | Polar residues | ||||
Sequence: TLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQ | ||||||
Region | 168-239 | Disordered | ||||
Sequence: TLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQKAFR | ||||||
Domain | 221-284 | bZIP | ||||
Sequence: TLRNTRRAAQNRTAQKAFRQRKEKYIKNLEQKSKIFDDLLAENNNFKSLNDSLRNDNNILIAQH | ||||||
Region | 223-247 | Basic motif | ||||
Sequence: RNTRRAAQNRTAQKAFRQRKEKYIK | ||||||
Region | 249-277 | Leucine-zipper | ||||
Sequence: LEQKSKIFDDLLAENNNFKSLNDSLRNDN |
Sequence similarities
Belongs to the bZIP family. YAP subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length383
- Mass (Da)43,597
- Last updated1996-11-01 v1
- Checksum396C20006DEB7319
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 168-235 | Polar residues | ||||
Sequence: TLPSRNTSVTTAPPSFQNSADTAKNSADNNDNNDNVTKPVPDKDTQLISSSGKTLRNTRRAAQNRTAQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z70202 EMBL· GenBank· DDBJ | CAA94098.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z68329 EMBL· GenBank· DDBJ | CAA92716.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
Z68329 EMBL· GenBank· DDBJ | CAA92717.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift | |
AY557790 EMBL· GenBank· DDBJ | AAS56116.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA12099.1 EMBL· GenBank· DDBJ | Genomic DNA |