Q03481 · Q03481_CHICK
- ProteinAlpha8 subunit of nicotinic acetylcholine receptor
- GeneCHRNA8
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids511 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | acetylcholine-gated channel complex | |
Cellular Component | axon | |
Cellular Component | cytoplasm | |
Cellular Component | dendrite | |
Cellular Component | neuron projection | |
Cellular Component | perikaryon | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic membrane | |
Cellular Component | synapse | |
Molecular Function | acetylcholine-gated monoatomic cation-selective channel activity | |
Molecular Function | excitatory extracellular ligand-gated monoatomic ion channel activity | |
Molecular Function | transmembrane signaling receptor activity | |
Molecular Function | transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Archelosauria > Archosauria > Dinosauria > Saurischia > Theropoda > Coelurosauria > Aves > Neognathae > Galloanserae > Galliformes > Phasianidae > Phasianinae > Gallus
Accessions
- Primary accessionQ03481
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Postsynaptic cell membrane ; Multi-pass membrane protein
Synaptic cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 6-25 | Helical | ||||
Sequence: CLGFFYSGLCLWASLFLSFF | ||||||
Transmembrane | 239-264 | Helical | ||||
Sequence: LYYGLNLLIPCVLISGLALLVFLLPA | ||||||
Transmembrane | 270-288 | Helical | ||||
Sequence: ISLGITVLLSLTVFMLLVA | ||||||
Transmembrane | 300-323 | Helical | ||||
Sequence: LIAQYFASIMVIVGLSVVVTVLVL | ||||||
Transmembrane | 479-503 | Helical | ||||
Sequence: LCLVAFTLFAIICTFTILMSAPNFI |
Keywords
- Cellular component
PTM/Processing
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-238 | Neurotransmitter-gated ion-channel ligand-binding | ||||
Sequence: RRLYRDLLRNYNRLERPVMNDSQPIVVELQLSLLQIIDVDEKNQVLITNAWLQMYWVDIYLSWDQYEYPGVQNLRFPSDQIWVPDILLYNSADERFDATFHTNVLVNYSGSCQYIPPGILKSTCYIDVRWFPFDVQKCDLKFGSWTHSGWLIDLQMLEADISNYISNGEWDLVGVPGKRNELYYECCKEPYPDVTYTITMRRRT | ||||||
Domain | 245-495 | Neurotransmitter-gated ion-channel transmembrane | ||||
Sequence: LLIPCVLISGLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASIMVIVGLSVVVTVLVLQFHHHDPQAGKMPRWVRVILLNWCAWFLRMKKPGENIKPLSCKYSYPKHHPSLKNTEMNVLPGHQPSNGNMIYSYHTMENPCCPQNNDLGSKSGKITCPLSEDNEHVQKKALMDTIPVIVKILEEVQFIAMRFRKQDEGEEICSEWKFAAAVIDRLCLVAFTLFAIICTFTI |
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length511
- Mass (Da)58,705
- Last updated1996-11-01 v1
- Checksum10F362D153EC87A7
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8V0YEF3 | A0A8V0YEF3_CHICK | CHRNA8 | 504 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X52296 EMBL· GenBank· DDBJ | CAA36544.1 EMBL· GenBank· DDBJ | mRNA |