Q03467 · E13B_PEA
- ProteinGlucan endo-1,3-beta-glucosidase
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids370 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Implicated in the defense of plants against pathogens.
Catalytic activity
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 127 | Proton donor | ||||
Sequence: E | ||||||
Active site | 272 | Nucleophile | ||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | glucan endo-1,3-beta-D-glucosidase activity | |
Biological Process | carbohydrate metabolic process | |
Biological Process | defense response |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameGlucan endo-1,3-beta-glucosidase
- EC number
- Alternative names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > fabids > Fabales > Fabaceae > Papilionoideae > 50 kb inversion clade > NPAAA clade > Hologalegina > IRL clade > Fabeae > Pisum
Accessions
- Primary accessionQ03467
Genome annotation databases
PTM/Processing
Features
Showing features for signal, modified residue, chain, propeptide, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-32 | |||||
Sequence: MASFFARTRRFSLVSLFLLELFTINLIPTTDA | ||||||
Modified residue | 33 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Chain | PRO_0000011855 | 33-347 | Glucan endo-1,3-beta-glucosidase | |||
Sequence: QIGICYGMMGNNLPPANEVIALYKANNIKRMRLYDPNQPALNALRDSGIELILGIPNSDLQTLATNQDSARQWVQRNVLNFYPSVKIKYIAVGNEVSPVGGSSWLAQYVLPATQNVYQAIRAQGLHDQIKVTTAIDMTLIGNSFPPSKGSFRSDVRSYLDPFIGYLVYAGAPLLVNVYPYFSHIGNPRDISLPYALFTSPGVMVQDGPNGYQNLFDAMLDSVHAALDNTGIGWVNVVVSESGWPSDGGSATSYDNARIYLDNLIRHVGKGTPRRPWATEAYLFAMFDENQKSPELEKHFGVFYPNKQKKYPFGFG | ||||||
Propeptide | PRO_0000011856 | 348-370 | Removed in mature form | |||
Sequence: GERRDGEIVEGDFNGTVSLKSDM | ||||||
Glycosylation | 361 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Expression
Tissue specificity
Constitutively expressed in seedling roots.
Induction
By fungal elicitors.
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length370
- Mass (Da)41,050
- Last updated1995-11-01 v1
- Checksum93847A4CF99B6186
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S51479 EMBL· GenBank· DDBJ | AAB24398.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
L02212 EMBL· GenBank· DDBJ | AAA33648.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S69419 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |