Q03445 · GLR1_DROME
- ProteinGlutamate receptor 1
- GeneGluRIA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids991 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists (By similarity).
Forms ligand-gated ion channels which are activated by kainate
Forms ligand-gated ion channels which are activated by kainate
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ionotropic glutamate receptor complex | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic density membrane | |
Molecular Function | glutamate receptor activity | |
Molecular Function | kainate selective glutamate receptor activity | |
Molecular Function | transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential | |
Biological Process | modulation of chemical synaptic transmission | |
Biological Process | monoatomic cation transport | |
Biological Process | synaptic transmission, glutamatergic |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameGlutamate receptor 1
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ03445
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Postsynaptic cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 28-611 | Extracellular | ||||
Sequence: QQQQQTVSLTEKIPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADAFKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDFAISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDGLLRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLGRFSKKRIVLDCPAEMAKEIIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFDEDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQ | ||||||
Transmembrane | 612-632 | Helical | ||||
Sequence: EIWISVILSYVGVSFVLYFVT | ||||||
Topological domain | 633-710 | Cytoplasmic | ||||
Sequence: RFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAA | ||||||
Transmembrane | 711-731 | Helical | ||||
Sequence: VWWFFTIILISSYTANLAAFL | ||||||
Topological domain | 732-895 | Extracellular | ||||
Sequence: TVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSN | ||||||
Transmembrane | 896-916 | Helical | ||||
Sequence: VAGIYYILIGGLLLAVIVAIM | ||||||
Topological domain | 917-991 | Cytoplasmic | ||||
Sequence: EFFCRNKTPQLKSPGSNGSAGGVPGMLASSTYQRDSLSDAIMHSQAKLAMQASSEYDERLVGVELASNVRYQYSM |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-27 | |||||
Sequence: MHSRLKFLAYLHFICASSIFWPEFSSA | ||||||
Chain | PRO_0000011555 | 28-991 | Glutamate receptor 1 | |||
Sequence: QQQQQTVSLTEKIPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADAFKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDFAISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDGLLRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLGRFSKKRIVLDCPAEMAKEIIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFDEDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIMEFFCRNKTPQLKSPGSNGSAGGVPGMLASSTYQRDSLSDAIMHSQAKLAMQASSEYDERLVGVELASNVRYQYSM | ||||||
Glycosylation | 67 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 195 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 208 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 281 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 376 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 385 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 426 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 437 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 477 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Central nervous system.
Developmental stage
No expression is seen in early embryogenesis, whereas high expression occurs in late embryos. During larval development, expression decreases to undetectable levels in late larvae, resumes at the early pupal stage and gradually increases in late pupae and early adult flies. High levels of expression coincide with major stages of neurogenesis.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 300-321 | Disordered | ||||
Sequence: DSRKRLEPSGQSQSQNAGGPNS | ||||||
Compositional bias | 307-321 | Polar residues | ||||
Sequence: PSGQSQSQNAGGPNS | ||||||
Region | 354-379 | Disordered | ||||
Sequence: FRSNHLQRRSHGGSSSSSATGTNESS | ||||||
Compositional bias | 360-379 | Polar residues | ||||
Sequence: QRRSHGGSSSSSATGTNESS |
Sequence similarities
Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q03445-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsA
- Length991
- Mass (Da)111,668
- Last updated2005-06-21 v2
- ChecksumC8917868ABA06F98
Q03445-2
- Name2
- Differences from canonical
- 1-265: Missing
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_014219 | 1-265 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 61 | in Ref. 1; AAA28575 | ||||
Sequence: M → L | ||||||
Sequence conflict | 301 | in Ref. 1; AAA28575 | ||||
Sequence: S → N | ||||||
Compositional bias | 307-321 | Polar residues | ||||
Sequence: PSGQSQSQNAGGPNS | ||||||
Sequence conflict | 309-316 | in Ref. 1; AAA28575 | ||||
Sequence: GQSQSQNA → AKAKARTQ | ||||||
Sequence conflict | 324 | in Ref. 1; AAA28575 | ||||
Sequence: A → P | ||||||
Compositional bias | 360-379 | Polar residues | ||||
Sequence: QRRSHGGSSSSSATGTNESS | ||||||
Sequence conflict | 747 | in Ref. 1; AAA28575 | ||||
Sequence: T → A | ||||||
Sequence conflict | 759 | in Ref. 1; AAA28575 | ||||
Sequence: Y → H | ||||||
Sequence conflict | 916 | in Ref. 1; AAA28575 | ||||
Sequence: M → V | ||||||
Sequence conflict | 944 | in Ref. 1; AAA28575 | ||||
Sequence: A → G |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
M97192 EMBL· GenBank· DDBJ | AAA28575.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014296 EMBL· GenBank· DDBJ | AAF50652.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT003218 EMBL· GenBank· DDBJ | AAO24973.1 EMBL· GenBank· DDBJ | mRNA | ||
BT050435 EMBL· GenBank· DDBJ | ACJ13142.1 EMBL· GenBank· DDBJ | mRNA |