Q03435 · NHP10_YEAST
- ProteinNon-histone protein 10
- GeneNHP10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids203 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probably involved in transcription regulation via its interaction with the INO80 complex, a chromatin remodeling complex.
Miscellaneous
Present with 1750 molecules/cell in log phase SD medium.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 94-158 | HMG box | ||||
Sequence: PKRPTNAYLLYCEMNKERIRQNGSLDVTRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYN |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Ino80 complex | |
Cellular Component | nucleus | |
Molecular Function | DNA end binding | |
Molecular Function | heteroduplex DNA loop binding | |
Biological Process | chromatin remodeling | |
Biological Process | DNA repair | |
Biological Process | double-strand break repair | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | telomere maintenance via recombination |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNon-histone protein 10
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Saccharomycetaceae > Saccharomyces
Accessions
- Primary accessionQ03435
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000048567 | 2-203 | Non-histone protein 10 | |||
Sequence: SVEEKKRRLEELKDQNVVLGLAIQRSRLSVKRLKLEYGVLLERLESRIELDPELNCEDPLPTLASFKQELLTKPFRKSKTKRHKVKERDPNMPKRPTNAYLLYCEMNKERIRQNGSLDVTRDLAEGWKNLNEQDRKPYYKLYSEDRERYQMEMEIYNKKISNIDADDDKEENEQKIKNNEEGSSTKVADSKGGEDGSLVSSN |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Component of the chromatin-remodeling INO80 complex, at least composed of ARP4, ARP5, ARP8, RVB1, RVB2, TAF14, NHP10, IES1, IES3, IES4, IES6, ACT1, IES2, IES5 and INO80.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q03435 | IES1 P43579 | 5 | EBI-12010, EBI-22775 | |
BINARY | Q03435 | IES5 P40060 | 5 | EBI-12010, EBI-22617 | |
BINARY | Q03435 | INO80 P53115 | 11 | EBI-12010, EBI-24019 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 78-97 | Disordered | ||||
Sequence: KSKTKRHKVKERDPNMPKRP | ||||||
Compositional bias | 161-189 | Basic and acidic residues | ||||
Sequence: ISNIDADDDKEENEQKIKNNEEGSSTKVA | ||||||
Region | 161-203 | Disordered | ||||
Sequence: ISNIDADDDKEENEQKIKNNEEGSSTKVADSKGGEDGSLVSSN |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length203
- Mass (Da)23,857
- Last updated1996-11-01 v1
- ChecksumEE6F488F78D32415
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 161-189 | Basic and acidic residues | ||||
Sequence: ISNIDADDDKEENEQKIKNNEEGSSTKVA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z48008 EMBL· GenBank· DDBJ | CAA88059.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BK006938 EMBL· GenBank· DDBJ | DAA11846.1 EMBL· GenBank· DDBJ | Genomic DNA |