Q03200 · LIRP1_ORYSJ
- ProteinLight-regulated protein, chloroplastic
- GeneLIR1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids128 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Thylakoid-determinant subunit of high molecular weight LFNRs-containing protein complexes.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | chloroplast thylakoid membrane protein complex | |
Biological Process | cellular response to light stimulus | |
Biological Process | circadian rhythm |
Names & Taxonomy
Protein names
- Recommended nameLight-regulated protein, chloroplastic
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ03200
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Retarded growth. Reduced photosynthetic electron transfer. Marked decrease in the accumulation of LFNR1 and LFNR2-containing thylakoid protein complexes.
PTM/Processing
Features
Showing features for chain, transit peptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000021599 | ?-128 | Light-regulated protein, chloroplastic | |||
Sequence: MQTAASSVVGLSAVLPAAVKGRSLQIQAPRRVALRVRAAAAAVAVEAAEVDYSSNISVFPMEACDLIGGEACNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPEEACDDLGGEFCKAT | ||||||
Transit peptide | 1-? | Chloroplast |
Post-translational modification
May form interchain disulfide bonds with LFNR1 and LFNR2.
Keywords
- PTM
Proteomic databases
Expression
Induction
Expression is controlled by light and by a circadian clock (PubMed:26941088, PubMed:8499615).
Transcripts accumulate progressively during the day and fade out during the night, however, mRNA stability is enhanced during the night. Low levels during the day, accumulates during the night (at protein level). Rapidly degraded upon illumination (at protein level); this degradation coincides with the release of the LFNR from the thylakoid membrane (PubMed:26941088).
Transcripts accumulate progressively during the day and fade out during the night, however, mRNA stability is enhanced during the night. Low levels during the day, accumulates during the night (at protein level). Rapidly degraded upon illumination (at protein level); this degradation coincides with the release of the LFNR from the thylakoid membrane (PubMed:26941088).
Interaction
Subunit
Component of high molecular weight thylakoid LFNRs-containing protein complexes containing LIR1, LFNR1, LFNR2, TIC62 and TROL proteins. Interacts directly with LFNR1 and LFNR2; LIR1 increases the affinity of LFNR1 and LFNR2 for TIC62 and subsequent thylakoid relocalization.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 58-72 | 1 | ||||
Sequence: VFPMEACDLIGGEAC | ||||||
Region | 58-125 | 2 X 15 AA approximate repeats | ||||
Sequence: VFPMEACDLIGGEACNVQMYPEAKLSSSAAVAVSRAAAEEVDRDYLSYDEPTTVFPEEACDDLGGEFC | ||||||
Repeat | 111-125 | 2 | ||||
Sequence: VFPEEACDDLGGEFC |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length128
- Mass (Da)13,317
- Last updated1993-10-01 v1
- Checksum389D19D008EBD4D2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X68807 EMBL· GenBank· DDBJ | CAA48706.1 EMBL· GenBank· DDBJ | mRNA | ||
AP002818 EMBL· GenBank· DDBJ | BAB16320.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP002969 EMBL· GenBank· DDBJ | BAB92145.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP003727 EMBL· GenBank· DDBJ | BAD45513.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008207 EMBL· GenBank· DDBJ | BAF03667.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014957 EMBL· GenBank· DDBJ | BAS69939.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000138 EMBL· GenBank· DDBJ | EAZ10195.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK067670 EMBL· GenBank· DDBJ | BAG90531.1 EMBL· GenBank· DDBJ | mRNA | ||
AK120535 EMBL· GenBank· DDBJ | BAH00058.1 EMBL· GenBank· DDBJ | mRNA |